KEGG   Ictalurus punctatus (channel catfish): 108255852Help
Entry
108255852         CDS       T04658                                 

Definition
(RefSeq) hexokinase-2-like
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Neomycin, kanamycin and gentamicin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ipu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108255852
   00051 Fructose and mannose metabolism
    108255852
   00052 Galactose metabolism
    108255852
   00500 Starch and sucrose metabolism
    108255852
   00520 Amino sugar and nucleotide sugar metabolism
    108255852
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    108255852
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    108255852
Enzymes [BR:ipu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     108255852
Membrane trafficking [BR:ipu04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    108255852
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
22
AA seq 913 aa AA seqDB search
MAFDLIKFTLCPSLEDFDRCRKDELLLIGDFFDVALPRTASEKVVKAALYEALVDQQILP
ERGALPGVAAQPVQLTQPTQPLPVTGRAEAVTEPEDKVVAGCEQPEAGTVDPGWQLALKE
LELEIKRQEYQTQLLRVREPERDAEGRRLDLAARQRKPVPLPRKLNSLRATSPCSGDAEH
TSPQPTPGPSSSVDKFLYHLRLSNENLMDVSLRFRREMDRGLGRDTNLTASVKMLPTFVR
STPDGTEKGDFLALDLGGTNFRVLRVKVSSNGKQTVEMENQIYAIPETLMRGSGTELFDH
IAECLANFLEKLGIKEQKLPLGFTFSFPCQQTKLDESFLVSWTKGFKANGVEGKDVVDLL
RKAIRRRGDFDIDIVAVINDTVGTMMTCGFDDHHCEIGLIVGTGTNACYMEEMRNLELVE
GDEGRMCVNMEWGAFGDDGALDDIRTDFDREIDAGSLNPGKQLFEKMISGMYMGELVRII
LVKMTKEGLLFQGRTTPELLVTGHFKTSYVSAIENDKSKEGLVCVEQVLRDLGLDPSPED
CVAVQRVCHIVSTRAAHLCAATLAAVLRQIRDNKAVDRLRTTIGVDGSVYKNHPQFARRL
HKMVRLLVPDCDVRFLRSEDGSGKGAAMVTAVAYRLAKQHAERQQVLDTLRLSREQLMEV
KRRMEVQMKRGLAQDTHNSATVKMLPTYVRATPDGTEHGDFLALDLGGTNFRVLLVRVRS
GKRRSVEMHNKIYTISQDVMQGTGEELFDHIVHCIADFLEYMGMKGASLPLGFTFSFPCH
QAGLNKGILLKWTKGFKASGCEGEDVAALLKDAIHRVEEFDLDVVAVVNDTVGTMMSCGY
ENPQCEVGLIVGTGTNACYMEEMRNVELVEGDEGRMCVNMEWGAFGDGGELDDIGTEFDR
AVDENSTNPGKQR
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgatttgattaagtttacgttgtgtccttcgttagaggactttgataggtgt
aggaaggatgagctgctccttattggagacttttttgatgtggcacttccccgtacggct
agcgaaaaggtggttaaagcagcgttgtatgaggcactcgtagatcaacagatcctaccg
gagcgtggagcacttccgggcgtcgccgcgcagcctgtgcagcttacgcagcctacccag
cctcttccggttaccggcagggcggaggccgtgactgagccggaggataaggttgttgcg
ggttgtgaacagcctgaggccggcacagtggaccccggttggcaactagcgctaaaagag
cttgagttggagattaagcggcaagagtaccagacgcagctcctgcgagttcgggagcct
gagcgggatgctgaagggagaaggctcgacctggcagctcggcagcggaagccggtgccg
ctgccacggaagctgaactccctgagagcaacctccccgtgttccggtgacgcagagcac
accagcccgcagccgactccagggccgtcctcatcggtggataagttcctgtaccacctc
cgtctgtccaacgagaacctgatggacgtgtccctgcgcttccggagggaaatggacaga
ggcctgggcagggacaccaacctcacagcctcggtcaaaatgctgcccacatttgtgcgc
tccacacctgatggcacagaaaaaggcgacttcctggcgctggacctcggcgggacgaac
ttccgagtcctgcgcgttaaagtgtcgtctaacggcaaacagacggtggagatggagaat
cagatttatgccattcctgagactctgatgaggggcagcgggacagagctgtttgaccac
atcgctgaatgtttggctaacttcctggagaaactgggtataaaggagcagaagctgccg
ctgggcttcaccttctccttcccctgccagcagaccaaacttgacgagagcttcctggtg
tcgtggaccaagggcttcaaggcgaacggggtggaggggaaagacgtggtggacctgctg
aggaaagccatcaggaggagaggggacttcgacatcgatattgtcgctgtgatcaacgac
accgtaggcaccatgatgacctgcggcttcgacgaccatcactgcgagatcggcctcatc
gtaggtacgggtacgaacgcgtgctacatggaggagatgaggaatctggagctggtggag
ggagacgagggccgcatgtgtgtgaacatggagtggggggcgttcggagacgacggcgct
ctcgacgacattcgcaccgacttcgaccgcgagatcgacgccggatcgctgaaccctggc
aaacagctatttgagaagatgatcagtgggatgtacatgggtgagctggtgcgcatcatc
ctggtgaagatgactaaagaaggactgctgttccagggccggaccacgcccgagctgctc
gtcaccggccacttcaaaaccagctacgtctcagccatcgagaatgacaagagtaaggaa
ggcctggtgtgcgtggaacaggttctgcgtgatctgggactggatccatctcctgaggac
tgtgtggcggtgcagcgcgtgtgtcatatcgtgtcgacgcgagcggctcacctgtgcgcc
gcgacgctcgccgccgtgctgcggcagatccgggacaacaaggccgtggatagattgcgc
accacgatcggagtggacggatccgtgtacaagaaccacccgcagtttgcgcggcggtta
cacaagatggtgcgcttgttggtgcctgactgtgacgtgcgtttcctgcgctcggaggac
ggcagcgggaagggcgcggccatggtaacggcggtggcctacaggttggcgaagcagcac
gccgagcgccagcaggtcctggacacgctgcggctcagccgggaacagctgatggaggtg
aagaggaggatggaggtgcagatgaagaggggactcgcccaggacacccacaactcggcc
accgtcaaaatgctgcccacctacgtcagagccacgcccgacggcacagagcacggagac
ttcctggcgctggatctgggcgggaccaacttccgagtgctgctggttcgagtgcgcagc
gggaagcggcgcagcgtggagatgcacaacaagatttacaccatttcacaggacgtcatg
cagggcacgggggaagagctgtttgatcacatcgtccactgcatcgctgacttcctggag
tacatgggaatgaagggagcgtcattacctctgggtttcaccttctcttttccctgccat
caagctggattgaacaagggcattctgctgaagtggacgaagggcttcaaggctagcggc
tgtgaaggcgaagacgtagcggcgctgctcaaagacgccattcatcgcgtggaggaattc
gatctggacgtggttgccgtggtgaacgacacggtggggacgatgatgtcgtgcggatac
gagaaccctcagtgtgaagtggggctcatcgtaggtacgggtacgaacgcgtgctacatg
gaggagatgaggaacgtggagctggtggagggagacgagggccgcatgtgtgtgaacatg
gagtggggggcgttcggagacggcggcgagctcgacgatatcggcaccgagttcgaccgc
gccgtggatgaaaactccaccaatcccggcaaacagaggtga

DBGET integrated database retrieval system