KEGG   Ictalurus punctatus (channel catfish): 108263365Help
Entry
108263365         CDS       T04658                                 

Gene name
hk1
Definition
(RefSeq) hexokinase 1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
ipu  Ictalurus punctatus (channel catfish)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Neomycin, kanamycin and gentamicin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ipu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108263365 (hk1)
   00051 Fructose and mannose metabolism
    108263365 (hk1)
   00052 Galactose metabolism
    108263365 (hk1)
   00500 Starch and sucrose metabolism
    108263365 (hk1)
   00520 Amino sugar and nucleotide sugar metabolism
    108263365 (hk1)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    108263365 (hk1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    108263365 (hk1)
Enzymes [BR:ipu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     108263365 (hk1)
Membrane trafficking [BR:ipu04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    108263365 (hk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
3
AA seq 918 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYSMRLSDETLRDIMSRFRMELVKGLSRDTNATAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILRVKVSHEKKQTVQMESQIYETPEDIMH
GSGTRLFDHVAECLGDFMEKQKIKDKKLPVGFTFSFPCAQTKLDEAVLLTWTKRFKASGV
EGMDVVKLLNKAIKKRGDYEADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGMLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAKEGMLFEGRITPELLTKGKIETKHVSAIEKSKEGLTKAKEILTRLG
VEPSADDCIAVQHVCAIISFRSANLVAATLCAILTRLKDNKNVPRLRTTVAIDGSLYKMH
PQYSRRLHKTVRRLIPECDVRFLLSESGSGKGAALVTAWAYRLADQTRQIAETLAEFRLS
KEQLLEVKKRMHTEIQNGLSKKSQGTATVKLLPTYVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPIEVMQGTGEELFDHIVTCISDFLDYMGMKNARLPLGF
TFSFPCRQTSLDAGILVNWTKGFKATDCEGEDVVNLLREGIKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCEVGLIAGTGSNACYMEEMRNIETVDGDEGRMCVNMEWGAFGDNGCLDD
IRTQYDRNVDDLSLNPGKQRYEKMCSGMYLGEIVRNILIDLTKRGFLFRGQISETLKTRG
IFETKFLSQIESDRLALLQVRTILQHLGLDSTCDDSIIVKEVCGAVSRRAAQICGAGMAA
VVDKIRENRRLDRLDITVGVDGTLYKLHPHFSRIMHQTVNELAPKCNVTFLLSEDGSGKG
AALITAVGCRLRQQEQKN
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgatagccgcacagcttctggcctactacttcactgagctgaaggatgatcaggtcaaa
aagattgataagtacctgtactccatgcgcctctctgatgagacactgcgagacatcatg
tcccgtttccgtatggagctggtgaaagggctgagccgtgacaccaacgcaacagccact
gtcaagatgctgcccaccttcgtcaggtccatccctgatggatcagagaagggggatttc
attgctctggatctgggaggctctaatttccgaatcctgagagtgaaagtttctcatgaa
aagaagcaaacagtgcagatggagagtcagatctatgagactccagaagacatcatgcat
ggcagtggaacacggctatttgaccatgttgctgaatgtctgggggactttatggagaag
caaaagatcaaagataagaaacttccagtgggattcaccttctctttcccttgtgctcaa
actaaactggatgaggctgttttgctgacctggacgaaacgtttcaaagccagtggagtg
gaggggatggatgtggtgaagcttctgaacaaagctattaaaaagcgaggggactatgaa
gctgatatcatggcggtggtcaatgacactgtgggaaccatgatgacctgtggctttgat
gaccagcgctgtgaagttgggattatcatcggtaccggcactaacgcatgctacatggag
gagttgagacatattgacctggtggagggagacgagggcaggatgtgcatcaacacagag
tggggagctttcggagacgatggcatgctggaggacattcgcactgaatttgatcgagaa
attgaccgtgggtctctcaaccctggcaaacaattgtttgagaagatggtgagtggaatg
tacatgggggagctggtgcggctcatcctagtgaagatggccaaagaggggatgctgttt
gaaggccgcatcactccagagctactgactaaaggaaaaattgaaacaaagcatgtttct
gctattgagaagagtaaagagggattgaccaaagccaaggaaattttaacccgtttggga
gtggagccatcagcggatgactgcatcgctgtgcagcacgtgtgtgctatcatctccttc
cgctcagccaatcttgtcgctgctacactgtgtgctatccttactcgcctgaaagacaac
aagaatgtccctcgtctccgcactaccgtggccatcgatggctcactctacaagatgcac
ccacagtattcccgtcggctccataagactgtgcgacgtctgatacctgagtgtgatgtt
cgcttcctgctttcggagagtggaagtggcaaaggtgccgccttggtaacagcctgggcc
tatagactggctgatcagacacgtcagattgccgagacactggcggagttccgcctcagc
aaagagcagcttttagaggtgaagaaaaggatgcacacagagatccagaatggcttgagc
aaaaagagccagggcacagctacagtgaagctgctgcccacttacgtgcgcagcacccca
gatggcacagaaaatggagacttcttggctttggaccttggaggcacaaactttagggtg
ctcttagtgaagattcgcagtggtaagagacggactgtggagatgcataacaaaatctat
gccattcctatcgaggtgatgcagggaacaggagaagagctttttgatcacatcgtcacc
tgcatatcggacttcctggattacatgggaatgaagaacgcaaggcttcctttgggcttc
actttctctttcccctgtagacaaaccagccttgatgctggcatcctggtaaactggacg
aagggctttaaggccacagactgtgaaggagaggatgtcgtcaatctcctaagagaaggg
attaaaaggagggaggaatttgacttggatgtcgtggcagtggttaatgatacagtggga
accatgatgacttgtgcttatgaggaaccaacatgtgaggttggccttattgcaggaacg
ggcagtaacgcctgttacatggaagaaatgaggaacatcgagacagtggatggagatgag
ggcaggatgtgtgtgaacatggagtggggtgcatttggggacaacggctgcctggacgat
atcaggacccagtatgaccgaaacgtggatgatctctccctcaaccctggcaagcagagg
tatgagaagatgtgcagtgggatgtacctgggtgagattgtgcgaaatatcctcattgac
ttgacaaagcgtggcttcctcttcaggggtcagatctctgagactctcaagactaggggc
atctttgaaaccaaattcctgtcccagattgagagtgaccggttggcgctactgcaagtc
cgaactattctgcagcacttgggtctggacagcacgtgcgacgacagtattatagttaag
gaagtgtgtggtgcagtgtcacgtcgagccgcacagatctgcggtgcgggaatggctgct
gtggtggacaaaatccgagagaatcgaagactagatcgtctggacatcactgtgggggtg
gatggcacgctctacaaactccatccgcatttctcccggataatgcaccagaccgtgaac
gaactcgcacccaagtgcaatgtgactttcctgctctctgaagacgggagcggaaaaggt
gctgctctgatcaccgctgtcggatgccgcctacgtcagcaagaacaaaagaactga

DBGET integrated database retrieval system