KEGG   Ictalurus punctatus (channel catfish): 108274082Help
Entry
108274082         CDS       T04658                                 

Gene name
ace
Definition
(RefSeq) angiotensin I converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
ipu  Ictalurus punctatus (channel catfish)
Brite
Enzymes [BR:ipu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     108274082 (ace)
Peptidases [BR:ipu01002]
 Metallo Peptidases
  Family M2
   108274082 (ace)
Exosome [BR:ipu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108274082 (ace)
CD molecules [BR:ipu04090]
 Proteins
  108274082 (ace)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
13
AA seq 1286 aa AA seqDB search
MEPMMHWAVLLLSLVGVGVALKPEWQPGKYDSTEAGAIQFVSDYNSTAEQVFYYSTEASW
EHKTNLTEYNSQQEVLASLEKQNFTEAWGKLAKETFPDALLDTFTDPTLKNLIKKIDVLG
PANLPTTERERYNLILSQMGSIYSTAKVCPKPAECWSLEPELTKILATSRSYKQLLYAWE
GWHNNSGVPLKPLYPEFVELSNKASVLDGFADTGAYWRSWYESPTFEQDLENLFKQLQPL
YLNLHAFVRRKLYNYYGPKYINLKGPIPAHLLGNMWAQSWNNIYDLMIPFPNKPNVDVTN
TMVAQGYNATHMFRVAEEFFTSLGLKEMPPKFWEKSMLEKPTGDQEVVCHASAWDFYNRE
DFRIKQCTTVTMEQLFTVHHEMGHVEYYLQYKDQPVSFRRGATPGFHEAIGDVLSLSVST
PKHLQTIGLLDTLTDDTETDTNYLLKMALEKIAFLPFGYLIDQWRWGVFSGHTPPERYNS
EWWYLRTKYQGICPPVRRTEEQFDAGAKYHIPGNTPYIRYFVSFILQFQFHQKLCQEAGH
TGPLHKCDIYRSAKAGAVLEKIMQFGSSKPWTEVLQETLGTNKMDASALMEYFRPITTWL
EEQNKQSGETLGWPDFEWMPPVPQGYPEDIAEKITDEAQAKLFLAEYNSTAEEVWNAYTE
ASWAYNTNINEENKQIMLQKNLDMANHTKTYGLQARKYDTTDFQDYSVKRILKKLSDLER
AALPDAQLREYNDLLASMETTYSVAKVCEDHGTCLPLDPDLNKIMAESRDYDRLLFAWQG
WRNASGRELRQSYKRYVELANLAARSNGHADNGAFWRSLYETPTFEQDLEALWKELQPLY
LNLHAYVRRALFKKYGKERINLKGPIPAHLLGNMWAQTWSGIMDLVNPYPEATQVDVTQA
MIDKGWDALKMFTESNDFFTSVGLEPMPLEFWNKSMLTKPADREVVCHASAWDFYNRKDF
RIKQCTVVDMDDLITVHHEMGHVQYFLQYKDQPISFRDGANPGFHEAIGDVLALSVSTPK
HLHTIGLLDKVEDNPESTINFLMSIALDKIAFLPFGYLMDQWRWKVFDGRISSDEYNKEW
WNLRLKYQGLCPPVTRTEEDFDPGAKFHIPANVPYVRYFVSFVIQFQFHKALCDAAGHTG
PLHNCDIYKSTKAGQLLGDVMKLGFSKPWPEAMALITGKPVMSVQPLMEYFEPLITWLEM
ENKKNGDVLGWPDYNWMPTTTAVVEEVNPTTVDFLGLSVDEAAAVAGQWVLLVLGIVLLV
STAFLAYKYRKSRRLHKKSISQMELK
NT seq 3861 nt NT seq  +upstreamnt  +downstreamnt
atggaacccatgatgcactgggccgtgttgctgctgtccctagtcggagtcggggtggct
ctgaaacctgagtggcagcctgggaagtacgattccacagaggctggggccattcagttt
gtgagtgattacaactcgactgctgagcaagtgttctactatagcacagaggcaagctgg
gagcataaaaccaacctgacggagtacaattcccagcaagaggtgctggcaagtctagag
aaacaaaatttcacagaagcatggggaaaactggctaaggaaacattccctgacgcactc
ctggacacctttactgatccaacactgaagaacctcatcaaaaagattgatgtcctagga
cctgccaacctccctaccacagagcgagagaggtacaatttgattctgagtcagatgggc
agcatctactccacggcaaaagtatgtcccaaaccagcggagtgctggtctttggagcct
gagttgacaaagattctggccacgtcccggagctacaagcagctactatacgcctgggaa
ggctggcacaacaactctggagtaccactcaaacccctttatcctgaatttgttgagctc
agcaacaaagcctccgttttggatggttttgcagacactggtgcttattggcgttcctgg
tacgagtctccaactttcgagcaggacctggaaaacctgttcaagcagctgcagcctctc
tacctgaacctgcacgcctttgtccgtcgcaagctgtataactactatggccccaagtac
atcaatctaaaaggccccatccctgcccatctgcttggaaacatgtgggcacaaagctgg
aacaacatctatgacttgatgatccctttccctaacaagcccaatgtggacgtgactaac
accatggttgcccaaggctacaatgccacccatatgtttcgggtggctgaagagttcttc
acctctcttggtctgaaggagatgcctcccaagttctgggagaagtccatgctggagaag
cccactggtgaccaagaggtggtctgccatgcctctgcgtgggacttttataaccgggag
gactttaggattaagcagtgtaccacagtaactatggagcagctctttactgtgcaccat
gagatggggcatgtagagtattacctgcaatacaaagaccagccagtaagcttcaggcga
ggagccacccctggcttccatgaggccattggagacgtgctgtcgctttctgtatcaaca
cccaaacacctgcagactattggcctgttggacacactaactgatgacactgaaactgac
acaaattacctgttaaagatggctttagagaagatagccttccttccttttggatacctc
attgatcagtggcgctggggtgtgttcagtggacatacaccacctgaacgctacaactca
gagtggtggtacctcagaacaaaataccaaggtatctgtccaccagtaagacggacagag
gagcagtttgatgctggggcaaaatatcatattccaggaaatactccatacatcagatac
tttgtgagcttcatcctgcagttccagtttcaccagaagctttgccaggaagctggacac
actggaccgctgcataagtgtgacatctatagatcagccaaggctggggctgttttagaa
aaaatcatgcagttcggttcctccaagccctggactgaggtgctacaagagactttgggc
acaaacaaaatggacgccagtgccttaatggagtactttcggcccatcactacctggtta
gaggaacagaacaaacagtcaggtgaaacactcggctggcccgactttgaatggatgcct
cctgttccacaaggttacccagaggacattgccgagaaaataaccgatgaggctcaggca
aagctgttcctggctgaatacaactccacagcagaggaagtctggaacgcttacacagag
gcttcgtgggcctacaacactaacatcaatgaagaaaacaagcagattatgctgcagaaa
aacctggacatggccaatcacacaaagacctacggtttgcaggcccgcaagtatgacact
actgatttccaggactactcagtgaaaaggatcctaaaaaaactcagtgatctggagagg
gctgcgctccctgacgctcagctgagagagtacaatgacttgttggcctccatggagacc
acatacagtgtagctaaagtctgtgaagatcatggtacctgtctacctcttgatccagac
ctaaataagatcatggctgagtccagggactacgacaggctgctgtttgcctggcagggc
tggcgaaatgcttcaggaagagaactgcgccaaagctacaagagatatgtagagcttgcc
aacttagctgccaggagtaacggtcacgctgacaatggcgctttctggcgctctttgtac
gaaacacccaccttcgagcaggatttggaggcgttatggaaagagctacagccgctctat
ctcaacctccatgcgtatgtccggagagcactcttcaaaaaatacggaaaggagcgcatc
aaccttaaaggtcccatccctgcacatttactaggaaacatgtgggcacagacctggtca
ggaatcatggacttggtgaacccgtaccctgaagccactcaagtggacgtcacacaagcc
atgatagacaagggctgggacgctctgaaaatgttcactgagtcgaacgacttcttcacg
tcagtgggcctggagcctatgcctttggaattctggaacaagtcaatgctgacgaagcct
gcagaccgtgaagtggtgtgtcatgcctcagcctgggacttttacaaccgcaaagacttc
aggattaagcaatgtacagtggtggacatggacgacctgatcacagtgcatcatgaaatg
ggccatgtgcagtatttcctccagtataaggaccagcccatctcgttccgtgacggcgcc
aacccgggattccatgaggccatcggggatgtgctggcgctttcagtgtccacacccaaa
caccttcacaccatcggcctgcttgataaggtcgaggacaacccggagagcaccataaac
ttcctgatgagcatcgccctggataaaatcgccttcctgcctttcggctacctgatggac
caatggaggtggaaggtgtttgatggcaggatatccagtgacgagtacaacaaggagtgg
tggaatctcaggctgaagtaccagggcttgtgtccacctgtaacccgcacagaggaagac
ttcgacccaggcgccaagttccacatcccagccaacgtgccctacgtcaggtacttcgtc
agctttgtgatccagttccagttccataaagctctgtgtgatgctgcgggtcacactgga
cctctccacaactgtgatatctataagtccacaaaggcaggacaactcctcggtgatgtg
atgaagctgggcttcagtaagccctggcccgaggcgatggccttgatcacaggtaagccc
gtgatgtctgtacagcctctgatggagtactttgagcccctcatcacctggctagagatg
gagaacaaaaagaacggcgacgtcctcggctggcccgactacaactggatgccaaccacg
actgcagttgtggaggaggtcaaccctactactgtggatttcttagggttaagtgtggat
gaagctgcagctgtagctgggcagtgggttctccttgtgctggggattgttctcctggtc
tccacagccttcttggcctacaaataccggaaatccagacgcctacacaagaagtccatc
tctcaaatggagctcaaatag

DBGET integrated database retrieval system