KEGG   Isoptericola variabilis: Isova_2904Help
Entry
Isova_2904        CDS       T01520                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
iva  Isoptericola variabilis
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Isova_2904
  Energy metabolism
   00680 Methane metabolism
    Isova_2904
Enzymes [BR:iva01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Isova_2904
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(3190500..3193259)
Genome map
AA seq 919 aa AA seqDB search
MSENQAQPTGVVTDPSPASAGARERVVARHEMPDPLRDDIRLLGGLLGTVLREAGGQDLL
DDVERLRELTIRAYGSDDGGTALAEAADLVAGFPLERAEQVARAFTCYFHLANLAEEYHR
VRVLRQRETEAGAAVDESLPHAFTQLAEEVGRDEALRRLSELEFRPVLTAHPTEARRRAV
SGAVRRISNLLAERDTMRPGGTSLVENERRLLAEIDTMWRTSPIRAAKPTVLDEVKTAMG
VFDATLFNTFPEVYRRLDDWLLDGDAGRAAPVARPFVFLGSWIGGDRDGNPNVTAEVTRQ
AATLAAEHALTALEEAARQVGRKLTLDEAGTPPSSALKALWQRLRQLSEDLTAQAAAVSP
REPHRAAVLAIAGRIGATRRRDADLAYRRPEELEAELRVVQDSLVEAGAPRAAYGDLQKL
VWQVQTFGFHLAEIEVRQHSQVHAAALDEIAEKGVHGDLSDRTREVLDTFRALGAVQRRF
GERAARRYIVSFTQAPEHLAAVYHLAELAFEDAEDIPVIDAIPLFETFADLEASVDILEA
ALELPQVQRRLAANGRRVEVMLGYSDSSKDVGPVAATLALHSAQSRIAEWARRHDITLTL
FHGRGGALGRGGGPANRAVLAQPPHSVDGRFKLTEQGEVILARYGDPTIAARHIEQVAAA
TLLASAPSTEKRNAATAERFAHVASSLDASSRARFHALVKSEGFPQWFAQVTPLEEIGLL
PIGSRPAKRGLSVNSLDDLRAIPWVFSWSQARINLAGWFGLGTALREFGDSPERIAELQA
AYREWPLFATLLDNVEMSLAKTDERIAAQYLALGDRDDLAQMVLDELRLTREWVLRVTGN
EWPLANRRVLGRAVQLRSPYVDALSLLQVRALRALRTEGASEGVTAESGKWVDGGYKDRW
QHLLLLTVNGVSAGLQNTG
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagaaccaggcacagcccaccggcgtcgtgaccgacccctcgcccgcctccgcg
ggcgcgcgcgagcgggtcgtggcccggcacgagatgcccgacccgctgcgcgacgacatc
cgcctgctcggcgggctcctcggcacggtcctgcgcgaggccggcggccaggacctgctc
gacgacgtcgagcggctgcgcgagctgaccatccgcgcgtacggctcggacgacggcggc
acggcgctcgccgaggcggccgacctcgtggccggcttcccgctcgagcgggccgagcag
gtggcgcgcgcgttcacgtgctacttccacctcgcgaacctggccgaggagtaccaccgc
gtgcgcgtgctgcgccagcgcgagaccgaggccggtgccgccgtcgacgagtcgctgccc
cacgcgttcacccagctcgccgaggaggtgggccgcgacgaggcgctgcgccggctgagc
gagctcgagttccgcccggtgctcaccgcgcacccgacggaggcgcgccgtcgggccgtc
tcgggagcggtgcggcgcatctcgaacctgctcgccgagcgcgacacgatgcgcccgggt
ggcacgtcgctcgtcgagaacgagcggcgcctgctggccgagatcgacacgatgtggcgc
acgtcgccgatccgtgcggccaagccgaccgtgctcgacgaggtcaagacggccatgggc
gtcttcgacgccaccctgttcaacacgttcccggaggtctaccgccggctcgacgactgg
ctgctcgacggcgacgccggacgcgcggcgcccgtcgcacggccgttcgtcttcctcggc
tcgtggatcggcggcgaccgcgacggcaaccccaacgtcaccgccgaggtcacgcgccag
gccgcgacgctcgcggccgagcacgcgctgaccgcgctcgaggaggcggcgcgccaggtc
ggccgcaagctcacgctcgacgaggccggcacgccgccgtcgtcggcgctcaaggcgctg
tggcagcggctgcgccagctctcggaggacctcacggcgcaggccgcggcggtgtcgccg
cgcgagccgcaccgcgccgcggtgctcgcgatcgcgggccgcatcggggccacgcggcgc
cgggacgcggacctcgcgtaccggcggcccgaggagctggaggccgagctgcgcgtcgtg
caggactcgctcgtggaggcgggcgcgccccgcgccgcgtacggcgacctccagaagctc
gtgtggcaggtccagacgttcggcttccacctcgccgagatcgaggtgcgccagcactcg
caggtgcacgccgcggcgctcgacgagatcgccgagaagggcgtgcacggcgacctgtcc
gaccgcacgcgcgaggtgctcgacaccttccgcgcgctcggggcggtgcagcgccgcttc
ggcgagcgggccgcgcgccgctacatcgtgtcgttcacgcaggcgcccgagcacctcgcg
gccgtctaccacctggccgagctggcgttcgaggacgccgaggacatcccggtcatcgat
gcgatcccgctgttcgagaccttcgcggacctcgaggcgtcggtcgacatcctcgaggcc
gcgctcgagctgccgcaggtccagcgccggctcgcggccaacggccgccgcgtcgaggtc
atgctcggctactcggactcctcgaaggacgtcgggcctgtcgcggccacgctcgcgctg
cactcggcgcagtcgcgcatcgcggagtgggcgcggcgccacgacatcacgctcacgctg
ttccacggccgcggcggggcgctgggccgcggcggcggcccggccaaccgcgcggtcctc
gcgcagccgccccactcggtcgacggccgcttcaagctcaccgagcagggcgaggtcatc
ctcgctcggtacggcgacccgacgatcgccgcgcgccacatcgagcaggtcgcggccgcg
acgctgctcgcctccgcgccgtcgaccgagaagcgcaacgccgccacggccgagcgcttc
gcgcacgtcgcgtcctcgctcgacgcgtcgtcgcgcgcccgcttccacgcgctcgtgaag
tcggagggcttcccgcagtggttcgcgcaggtcacgccgctcgaggagatcggcctgctg
ccgatcggctcgcgcccggccaagcgaggcctgtcggtcaactcgctcgacgacctgcgc
gcgatcccgtgggtgttctcgtggtcgcaggcgcgcatcaacctggccggctggttcggg
ctcgggacggcgctgcgcgagttcggcgacagcccggaacgcatcgcggagctccaggcg
gcgtaccgggagtggccgctgttcgcgacgctgctcgacaacgtcgagatgtcgctcgcc
aagaccgacgagcgcatcgctgcccagtacctcgcgctcggcgaccgcgacgacctcgcg
cagatggtgctcgacgagctgcgcctcacgcgcgagtgggtgctgcgcgtgacgggcaac
gagtggccgctcgccaaccgccgcgtcctcgggcgtgccgtgcagctgcgctcgccctac
gtcgacgcgctgtccctgctccaggtccgcgccctgcgcgcgctgcgcaccgagggcgcg
agcgagggcgtgaccgccgagtccggcaagtgggtcgacggcgggtacaaggaccgctgg
cagcacctgctgctgctcaccgtcaacggcgtcagcgcgggcctgcagaacaccggctga

DBGET integrated database retrieval system