KEGG   Jannaschia sp. CCS1: Jann_0831Help
Entry
Jann_0831         CDS       T00330                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
jan  Jannaschia sp. CCS1
Pathway
jan00020  Citrate cycle (TCA cycle)
jan00310  Lysine degradation
jan00380  Tryptophan metabolism
jan01100  Metabolic pathways
jan01110  Biosynthesis of secondary metabolites
jan01120  Microbial metabolism in diverse environments
jan01130  Biosynthesis of antibiotics
jan01200  Carbon metabolism
Module
jan_M00009  Citrate cycle (TCA cycle, Krebs cycle)
jan_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:jan00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Jann_0831
  Amino acid metabolism
   00310 Lysine degradation
    Jann_0831
   00380 Tryptophan metabolism
    Jann_0831
Enzymes [BR:jan01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     Jann_0831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N DMA
Motif
Other DBs
NCBI-ProteinID: ABD53748
JGI: Jann0831
UniProt: Q28U64
LinkDB All DBs
Position
785114..788071
Genome map
AA seq 985 aa AA seqDB search
MNDQSPNDTFHASSFMQGHNAEYLEQLYAQYAKDPAAVDAAWADFFAQLGDAEDAMAPAE
GPSWARTDWPPMPGDDLTAALTGDYPLPAEAKEAGKKIKAKAEETGVELSDDQIQRAVLD
SIRALMIIRAYRIRGHLVADLDPLGMRDQTPHPELDPASYGFEDADMDRPIFIDNVLGLE
MATMRQIVEIVRRTYCGTFALQYMHISNPVEASWLKERIEGYGKEIAFTKNGRKAILNKM
VEAEGFEKFLHVKYMGTKRFGLDGGESLIPAMEQIIKRGGALGVEEIIIGMPHRGRLSVL
ANVMQKPYRAIFNEFQGGSFKPEDVDGSGDVKYHLGASSDREFDGNTVHLSLTANPSHLE
AVNPVVLGKVRAKQDQKKDKERTKVMGVLLHGDAAFAGQGVVAEGFGLSGLRGHRTGGTI
HIVVNNQIGFTTAPHFSRSSPYPTDIALMVEAPIFHVNGDDPEAVVHAARVATEFRQKFH
KDVVLDIFCYRRFGHNEGDEPMFTNPIMYKKIKTQKTTLAIYTERLVKDGLIPEGEIEDM
KASFQAYLSEEFEAGKDYKPNKADWLDGRWSHLDRKDQDDYQRGQTAIAPETFDEIGKAL
STAPEGVSLHKTVGRLLDTKAKMFETGKGFDWATGEALAFGSLLTEGYPVRLSGQDSTRG
TFSQRHSGLVDQETEERYYPLNHVREGQAHYEVIDSMLSEYAVLGFEYGYTLAEPNALTL
WEAQFGDFANGAQIMFDQFISSGESKWLRMSGLVMLLPHGYEGQGPEHSSARLERFLQMC
GGDNWIVANCTTPANYFHILRRQIHRDFRKPLVLMTPKSLLRHKLAVSETEDFTTGSSFH
RCLWDDAQKGNSDTELVADDKIKQVVICSGKVYFDLLEERDERGIDDVYLLRLEQFYPFP
ALSLTKELERFKQAKIVWCQEEPKNQGAWSFIEPNLEWVLTRIGADTQRPRYAGRTASAS
PATGLASAHKSQQAALVDSALTIEG
NT seq 2958 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaccaatctcccaacgataccttccatgcctccagcttcatgcaggggcacaat
gcggaatatctggaacagctttacgcgcaatatgccaaggacccggcggcggtggatgcc
gcctgggcggatttctttgcgcaattgggcgatgccgaggatgcgatggccccggccgaa
gggccatcctgggcgcgcactgattggccgccaatgccgggcgatgatctgacggcggcc
ctgaccggggactatccgctacccgcagaagccaaggaggccggcaaaaagatcaaggcc
aaggccgaagagacgggcgttgagctgagcgatgatcagatccaacgcgccgtcctcgac
agtatccgcgcgctcatgatcattcgcgcctaccgcatccggggccatctggtcgccgat
ctggaccccctgggcatgcgcgaccagaccccgcacccggaactggacccggcgtcctac
gggtttgaagacgcggacatggatcgcccgatcttcatcgacaacgtgcttgggctggaa
atggccaccatgcgccagatcgtggagatcgtgcggcggacctattgcggcaccttcgcg
ctgcaatacatgcacatctccaaccccgtggaagcgtcttggctgaaggaacggatcgag
ggttacggcaaggagattgcattcaccaagaacgggcgcaaagcgatcctgaacaagatg
gtggaggcggaagggttcgaaaagttcctccacgtcaagtacatgggcacaaagcggttt
ggtctggacggcggcgaaagcctgatccccgcgatggagcagatcatcaagcggggcggc
gcgttgggggtggaagagatcatcatcggcatgccccaccgggggcgtctgtcggttctg
gccaatgtcatgcaaaagccctatcgcgcgattttcaacgaatttcagggcgggtcgttc
aagccggaggacgtcgatggctcgggcgatgtgaagtaccatttgggcgcctcatccgac
cgggagtttgacggcaacaccgttcacctgtcgctgacggccaacccgtcgcacctggag
gccgtgaacccggttgtcctcggcaaggtccgtgccaagcaggatcagaagaaagacaag
gagcgcacgaaggttatgggcgtgttgctgcacggtgacgcggcctttgccggtcagggc
gtggtggcagaaggctttggcctgtccggcctgcgcgggcaccggaccgggggcacgatc
cacatcgtcgtgaacaaccagatcggattcacgactgcgccgcatttcagccgctccagc
ccttatccgacggacatcgcgctgatggttgaagcgccaatattccacgtgaacggagat
gatccagaggctgtcgtccatgccgcccgcgtggcgacggagtttcggcagaaattccac
aaggacgtggtcctcgacattttctgttaccgccggtttggccataacgagggtgatgag
cccatgttcaccaacccgatcatgtataagaagatcaagacgcagaagacgacgctggcg
atttacaccgaacgccttgtcaaagacgggctgatccccgagggcgagatcgaggatatg
aaagcctcattccaggcctacctgagtgaggagttcgaggccgggaaagactacaagccc
aacaaggccgattggctcgacgggcggtggtcgcatctggatcgcaaggatcaggatgac
taccagcgcgggcaaaccgcgatcgcgccggagacgtttgacgagatcggcaaagccctg
tcgaccgcaccagagggtgtcagcctgcacaagacggtcgggcgattgctggacacgaaa
gccaagatgttcgagacgggcaaagggtttgactgggccactggtgaggcgctggcgttt
gggtctttgctgaccgaaggctatccggtgcggctctcgggccaggacagcacccgcggg
acattctcgcagcggcattccggccttgtcgatcaggaaacggaagagcggtactacccg
ctgaaccatgtgcgcgaggggcaggcacattacgaggtgatcgactcgatgctctcggaa
tacgccgtgttggggtttgagtacggctacacgctggccgagcccaacgcgctgacgctt
tgggaagcgcagttcggtgatttcgccaatggggcacagatcatgtttgatcagttcatc
tcatcgggtgaaagcaaatggctgcggatgtccggcttggtgatgctgttgccccacggg
tatgaggggcaggggccggagcattccagcgcgcgattggagcggttcttgcagatgtgc
ggcggcgacaactggatcgtcgcgaactgcacgacaccagcgaactacttccacattctg
cgccgtcagatccaccgggatttccgcaagccgctggttttgatgacgccgaagtcgctg
ctgcgtcacaagctggcggtgtcggaaacggaggatttcaccaccgggtccagcttccat
cgctgcctttgggatgatgcccaaaaggggaactcggacacggaactggtggccgacgac
aagatcaagcaggtcgtcatctgctcgggcaaagtctatttcgacctgctggaagagcgt
gacgaacgcggcattgatgatgtctacctgctgcggctggaacaattctacccattcccg
gcgctgtcgctgaccaaggaattggagcgcttcaagcaggccaagatcgtctggtgccag
gaagagcccaagaaccagggcgcatggtcgtttatcgagcccaatctggagtgggttttg
acccgcatcggtgctgacacccaacgcccgcgctacgcgggacgcacagcctcggcctcg
cccgcgacgggcctggcctccgcccacaaatcccaacaagccgcactcgttgacagtgca
ctgaccatcgaagggtaa

DBGET integrated database retrieval system