KEGG   Kitasatospora aureofaciens: B6264_18165Help
Entry
B6264_18165       CDS       T05021                                 

Definition
(GenBank) kynureninase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
kau  Kitasatospora aureofaciens
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kau00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    B6264_18165
Enzymes [BR:kau01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     B6264_18165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4126290..4127516)
Genome map
AA seq 408 aa AA seqDB search
MITREECAALDAADPLAAFRKEFTLPDGVIYLDGNSLGALPVRTPERVAQVVEQEWGREL
IRSWNDAGWFEQPYRLGRRIAPLIGADPAEVVVCDTTSVNLFKVLSAALELRPGRRTVLG
DAEAFPTDLYIAEGVTGQVEGGRSVLVHPEELDRHLDGDVAAVVLSHVDYRTGELLDMPG
ITARVQAAGALMIWDVCHSVGALPVELGAAKADFAVGCTYKYLNSGPGAPAFLYVAERHL
AAGPRQPLSGWFGHARPFAFEPGYDPKPGIGRFLTSSPSLLGQAALGASLDVWERADLAA
VRTKSLALTDLFVSLVEGLDGVEVVTPREHARRGSQVALRHADGYPVVQALIARGVIGDF
RAPDLMRFGFTPLYLSYTEVWDAARQLAEVLASGEWREERFSRRGEVT
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgatcacgcgcgaggagtgcgcggcgctggacgccgccgacccgctggcggcgttccgc
aaggagttcaccctgccggacggggtgatctacctggacggcaactcgctgggcgcgctg
ccggtgcgcacgcccgagcgggtggcgcaggtggtcgagcaggagtggggccgggagctg
atccgcagctggaacgacgccggctggttcgagcagccgtaccgcctggggcgccggatc
gcgccgctgatcggcgccgatccggcggaggtggtcgtctgcgacaccacctcggtgaac
ctgttcaaggtgctctcggcggcgctggagctgcgcccggggcggcgcacggtgctgggc
gacgccgaggccttccccaccgacctgtacatcgccgagggcgtgaccggtcaggtcgag
ggcgggcgcagcgtgctggtgcaccccgaggagctggaccggcacctggacggcgacgtc
gccgcggtggtgctgtcgcacgtggactaccgcaccggcgagctgctggacatgcccggt
atcaccgcccgggtgcaggccgcgggcgccctgatgatctgggacgtgtgccactcggtg
ggtgcgctgccggtcgaactcggcgccgccaaagcggacttcgcggtcggctgcacgtac
aagtacctgaactcgggccccggcgccccggccttcctgtacgtcgccgagcggcacctg
gcggccggtccgcggcagccgctgagcggctggttcgggcacgcccgcccgttcgccttc
gagcccgggtacgaccccaagccgggcatcgggcgcttcctgaccagctcgccctcgctg
ctcggccaggccgccctgggcgcctcgctggacgtctgggagcgcgccgatctggccgcc
gtacggacgaagagcctggcgctgaccgacctgttcgtctcgctggtcgagggcctggac
ggggtcgaggtggtgaccccgcgcgagcacgcccgacggggcagccaggtcgcgctgcgg
cacgcggacggctacccggtggtgcaggcgctgatcgcgcgcggggtgatcggggacttc
cgcgcgccggacctgatgcggttcggcttcacgccgctctacctctcgtacaccgaggtg
tgggacgcggcccggcagctggccgaggtgctggcgagcggcgagtggcgggaggagcgc
ttctcccgtcggggcgaggtgacctga

DBGET integrated database retrieval system