KEGG   Kribbella flavida: Kfla_5287Help
Entry
Kfla_5287         CDS       T01155                                 

Definition
(GenBank) DNA polymerase LigD, polymerase domain protein
Organism
kfl  Kribbella flavida
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: ADB34301
UniProt: D2PL46
LinkDB All DBs
Position
5703513..5704520
Genome map
AA seq 335 aa AA seqDB search
MAESTAGSKAKSTAKKTAKSKSPSIELEVGERTVRISNPDRVYFPARGETKLDLVKYYLS
VGDGIVRALRERPCMLHRFPDGVAGEKVHQKRLPHGAPAWMETVRVHFPRYNRTADELCV
TEVAHVAWAVQMSTVEFHPWNSRRSDTEKPDEWRIDLDPMPDCPFDRVRRVAHVAHEVLD
ELGAVGYPKTSGGSGIHIYVRIKPDHGFADVRRAALAFAREVERRAPDDVTTTWWRKDRD
PAKLFVDFNQNARDHTIAAAYSVRGNPEGTVSTPIRWDEIDDVDPREFTIATVPARFAEL
GDLHAGIDDDVYTLDTLLEWAERDEREGAEVPPED
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggctgagtccacagcgggatcaaaggcgaagagcacggccaagaagacggcgaagagc
aagagcccgtcgatcgagctggaggtcggcgagcgcacggtccggatctccaaccccgac
cgggtgtacttcccggcgcgtggcgagacgaagctcgacctggtgaagtactacctgtcc
gtcggcgacggcatcgtgcgcgcgctgcgggagcgaccgtgcatgctgcaccggtttccc
gacggcgtcgccggcgagaaggtgcaccagaagcgcctgccgcacggcgcaccggcgtgg
atggagaccgtgcgggtgcacttcccccgctacaaccggaccgccgacgagctgtgcgtc
accgaggtcgcgcacgtcgcctgggcggtgcagatgtcgacggtcgagttccacccgtgg
aacagccgccgctccgacaccgagaagccggacgagtggcggatcgacctcgacccgatg
ccggactgcccgttcgaccgggtccgccgggtcgcgcacgtggcgcacgaggtgctcgac
gagctcggcgccgtcggatacccgaagacctccggcgggtccggcatccacatctacgtc
cggatcaagcccgaccacggcttcgccgacgtacgccgcgccgcgctggccttcgcccgc
gaggtggagcggcgcgcgcccgacgacgtcacgacgacctggtggcgcaaggaccgcgac
ccggcgaagctcttcgtggacttcaaccagaacgcccgcgaccacacgatcgccgccgcc
tactcggtgcgcggcaaccccgagggcacggtctccacgccgatccgctgggacgagatc
gacgacgtcgacccgcgggagttcaccatcgccaccgttcccgcccgtttcgcggagctc
ggtgacctgcacgccggcatcgacgacgacgtctacaccctcgacaccctgctcgagtgg
gccgagcgcgacgaacgcgaaggcgccgaggtcccaccggaggactga

DBGET integrated database retrieval system