KEGG   Kribbella flavida: Kfla_5357Help
Entry
Kfla_5357         CDS       T01155                                 

Definition
(GenBank) DNA polymerase LigD, polymerase domain protein
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
kfl  Kribbella flavida
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:kfl00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Kfla_5357
Enzymes [BR:kfl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Kfla_5357
DNA repair and recombination proteins [BR:kfl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Kfla_5357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5776361..5777287
Genome map
AA seq 308 aa AA seqDB search
MAAGPTQLTTEVDGQTMKLTNLGKVLYPQTGFTKAEVIDYYHQIAPLLLPHLTDRPLTRK
RWPDGTGAAYFFEKNAPRGTPDWVRTVTLPTPGSSTGRDEADFVIADDVQTIVWLANLAA
LELHVPQWRIGLSDDGKDPQADLVVFDLDPGPGVTIVECCDVALALRELLGHYGLEGWPK
TSGNKGMHLYVPIEPASSRATSAFAKQLAEQLAEALPENVTANMTKALRPGKVFIDWSQN
ASAKTTLAPYSLRGAEEPRVSTPIDWDEVAAATDQAELTFLPHEVLARVEQYGDVLEDLY
DDPRPLPS
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcggccggacccacccaactgaccaccgaggtcgacgggcagacgatgaagctcacc
aacctcggcaaagtgctctacccgcagacaggtttcacgaaggcggaggtgatcgactac
taccaccagatcgccccgctgctgctgccgcacctgacggaccggccgctgacccgcaaa
cgctggccggacggcaccggcgcggcgtacttcttcgagaagaacgcaccgcgcggtacg
ccggactgggtgcgcaccgtgaccctgccgacgcccggcagctccaccggccgggacgag
gcggacttcgtgatcgccgacgacgtgcagacgatcgtgtggctggcgaacctggccgcg
ctggagctgcacgtcccgcagtggcggatcgggctgtccgacgacggcaaggacccgcag
gccgacctggtcgtgttcgacctcgacccggggcccggagtcaccatcgtcgagtgctgc
gacgtggcgctcgccctgcgggagctgctcggtcactacgggctggagggctggccgaag
acctccggcaacaagggcatgcacctgtacgtgccgatcgagccggcctcgtcgcgggcg
accagcgcgttcgccaagcaactcgcggagcagctggccgaggcgctgccggagaacgtg
accgcgaacatgacaaaggcgctgcgacccggcaaggtgttcatcgactggagccagaac
gccagtgccaagaccacgctcgcgccgtactcgctgcgcggcgccgaggaacccagggtg
tccaccccgatcgactgggacgaggtcgccgcggccaccgaccaggccgagctgaccttc
ctgccgcacgaggtgctggcccgcgtcgagcagtacggcgacgtactggaggacctgtac
gacgacccgcggccattgccgtcctga

DBGET integrated database retrieval system