KEGG   Kocuria flava: AS188_06870Help
Entry
AS188_06870       CDS       T04206                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
kfv  Kocuria flava
Pathway
kfv00020  Citrate cycle (TCA cycle)
kfv00480  Glutathione metabolism
kfv01100  Metabolic pathways
kfv01110  Biosynthesis of secondary metabolites
kfv01120  Microbial metabolism in diverse environments
kfv01130  Biosynthesis of antibiotics
kfv01200  Carbon metabolism
kfv01210  2-Oxocarboxylic acid metabolism
kfv01230  Biosynthesis of amino acids
Module
kfv_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:kfv00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AS188_06870
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AS188_06870
Enzymes [BR:kfv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AS188_06870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ALU39522
UniProt: A0A0U2XML3
LinkDB All DBs
Position
complement(1526112..1528334)
Genome map
AA seq 740 aa AA seqDB search
MAKIIYTRTDEAPLLATYSFKPVVEAFASTAGVEVETRDISLAGRIVAAFSDRLPEDQRM
ADALAELGELAKTPEANIIKLPNISASVPQLKAAVKELQGQGFDLPDYPDEPGTDEEKEV
RARYDKIKGSAVNPVLREGNSDRRAPASVKNYARKNPHRMGEWSADSRTNVATMGADDFR
ANEQSVVVAEDGALSIRLVAEDGSTTVLKESVPVLAGEVVDSTVMRAAALDAFLAEQVER
AKREDVLFSVHLKATMMKVSDPIIFGHVIEAFFPELFAAHGEALREAGLSPDNGLAAILN
GLDDLPAGVRDEVRAAVDKGLAEGPKLAMVNSDKGITNLHVPSDVIVDASMPAMIRTSGH
MWGPDGEEADTLAVLPDSSYAGVYQVVIDDCRRNGAFDPRTMGSVPNVGLMAMKAEEYGS
HDKTFEIPAAGRVQVVDGSGTVLMEHEVAAGDIWRACQTKDVAVRDWVKLAVTRARATGS
PAVFWLDRGRAHDANLIAKVEQYLGEHDTEGLQLEIMSPEEATAFSLERIRRGEDTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLINGGGLFETGAGGSAPKHVQQLVEENHLRWD
SLGEFLALAASFDHLATRYDNARAQVLADTLDRATGTFLEENKSPSRKAGEIDNRGSHFY
LALYWAQELARQDADAELARAFAAVAQELAENEQAINEELLAVQGRPADIGGYYRPDDAK
TTAVMRPSETFNRVLASLSA
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagatcatctacacccgcaccgacgaggcgccgctgctcgccacctactccttc
aagccggtcgtcgaggccttcgcctccaccgccggcgtcgaggtggagacccgcgacatc
tcgctggccggccgcatcgtcgcggccttctccgaccgcctgccggaggaccagcggatg
gccgacgccctcgccgagctgggcgagctggccaagacccccgaggccaacatcatcaag
ctgccgaacatctcggcctccgtgccgcagctcaaggccgccgtcaaggagctccagggc
cagggcttcgacctgccggactacccggacgagccggggaccgacgaggagaaggaggtc
cgggcccggtacgacaagatcaagggctcggccgtcaacccggtgctgcgcgagggcaac
tccgaccgccgcgcccccgcctcggtgaagaactacgcccggaagaacccgcaccgcatg
ggcgagtggtccgccgactcgcgcaccaacgtcgcgaccatgggcgccgacgacttccgc
gccaacgagcagtccgtcgtcgtcgccgaggacggcgccctgagcatccgcctggtcgcc
gaggacggctcgaccaccgtcctcaaggagtccgtgccggtgctcgccggcgaggtcgtg
gactccaccgtgatgcgcgccgccgccctggacgcgttcctggccgagcaggtcgagcgc
gccaagcgcgaggacgtgctgttctcggtgcacctgaaggccaccatgatgaaggtctcc
gacccgatcatcttcggccacgtgatcgaggcgttcttccccgagctcttcgccgcgcac
ggcgaggcgctgcgcgaggccgggctgagcccggacaacggcctcgccgcgatcctcaac
ggcctcgacgacctccccgccggcgtgcgggacgaggtgcgggccgccgtcgacaagggg
ctcgccgagggcccgaagctcgcgatggtcaactcggacaagggcatcacgaacctgcac
gtgccctccgacgtcatcgtcgacgcctcgatgcccgcgatgatccgcacctccgggcac
atgtggggcccggacggcgaggaggccgacaccctcgcggtgctcccggacagctcctac
gccggggtctaccaggtcgtcatcgacgactgccgcaggaacggcgccttcgacccgcgc
accatgggctccgtgcccaacgtcgggctcatggccatgaaggccgaggagtacggctcc
cacgacaagaccttcgagatccccgccgccggccgcgtgcaggtcgtggacggctccggg
accgtgctcatggagcacgaggtcgccgccggcgacatctggcgggcctgccagaccaag
gacgtcgccgtgcgcgactgggtcaagctggccgtcacccgcgcccgcgccaccggctcc
cccgcggtgttctggctggaccgcggccgcgcccacgacgccaacctgatcgccaaggtc
gagcagtacctgggcgagcacgacaccgagggcctgcagctggagatcatgtcccccgag
gaggccaccgccttctcgctcgagcggatccgccgcggcgaggacaccatctccgtcacc
ggcaacgtgctgcgcgactacctcaccgacctgttcccgatcctcgagctgggcacctcc
gcgaagatgctctccgtggtgccgctgatcaacggcggcggcctgttcgagacgggcgcc
ggcgggtcggccccgaagcacgtccagcagctggtggaggagaaccacctgcgctgggac
agcctcggcgagttcctcgccctggcggcgagcttcgaccacctggccacccgctacgac
aacgcccgcgcccaggtcctggccgacaccctggaccgcgcgaccgggaccttcctcgag
gagaacaagtcccccagccgcaaggccggggagatcgacaaccggggcagccacttctac
ctggccctgtactgggcccaggagctcgcccggcaggacgccgacgccgagctggcccgg
gcgttcgcggccgtcgcgcaggagctggccgagaacgagcaggcgattaacgaggagctg
ctcgccgtgcagggccgcccggccgacatcggcgggtactaccgtcccgacgacgcgaag
accaccgcggtgatgcgcccgtcggagaccttcaaccgggtgctggcctcgctcagcgcc
tga

DBGET integrated database retrieval system