KEGG   Kluyvera intermedia: AB182_17480Help
Entry
AB182_17480       CDS       T03950                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
kin  Kluyvera intermedia
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kin00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AB182_17480 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    AB182_17480 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AB182_17480 (gpmA)
Enzymes [BR:kin01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     AB182_17480 (gpmA)
Membrane trafficking [BR:kin04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    AB182_17480 (gpmA)
Exosome [BR:kin04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   AB182_17480 (gpmA)
  Exosomal proteins of melanoma cells
   AB182_17480 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2966078..2966830
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGVSEAKAAGKLLKDEGFTFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERFPGHDPRYAKLTEKELPTTESLALTIERVVPYWNETILPRLKSGERVI
IAAHGNSLRALVKYLDNMGEDEILELNIPTGVPLVYEFDENFKPVKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgttactaaactggttctggttcgtcacggcgaaagccagtggaacaatgaaaac
cgcttcaccggttggtatgacgttgatctgtccgagaaaggcgttagcgaagcaaaagcc
gcaggtaagctgctgaaggatgaaggcttcaccttcgactttgcatacacctcggtgctg
aaacgtgccatccacaccctgtggaatgtgctggacgaactggatcaggcctggctgccg
gttgagaaatcctggaaactgaacgagcgtcattacggtgcgctgcagggtctgaacaaa
gcggaaaccgctgaaaaatacggtgacgagcaggttaaacagtggcgtcgcggctttgct
gttactccgccggaactgacgaaagatgacgagcgtttcccgggccacgatccgcgttat
gcgaaactgaccgagaaagagctgccgaccaccgaaagcctggcgctgactatcgaacgc
gtagtgccttactggaacgaaaccattctgccgcgcctgaaaagcggtgagcgcgtaatc
atcgcggctcacggcaactccctgcgcgcgctggtgaaatacctggataatatgggcgaa
gacgaaattcttgaactgaatatcccgaccggcgtgccgctggtgtatgagttcgacgaa
aacttcaaacctgtcaaacactactacctgggtaatgccgatgagatcgcggcgaaagcg
gctgccgttgccaaccagggtaaagcgaagtag

DBGET integrated database retrieval system