KEGG   Enterobacter lignolyticus G5: AO703_14755Help
Entry
AO703_14755       CDS       T04198                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
kle  Enterobacter lignolyticus G5
Brite
Enzymes [BR:kle01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     AO703_14755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3205256..3205882
Genome map
AA seq 208 aa AA seqDB search
MIDLYYAPTPNGHKVTLFLEEAQLAYRLIRVDISKGDQFRPEFLSISPNNKIPAIVDHVP
ADGGAPLALFESGEILLYLAEKSGKLLSGELRERHVTLQWLFWQVGGLGPMLGQNHHFNH
FAPQPVPYAIERYQVETLRLYNVLNKRLERSPWLGGEHYSIADIACWPWINAHQRQRIDL
DNFPAVKNWFERISQRPATVLAMQKAQA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgattgatctctattatgctcctaccccaaacggccacaaagtcacgctgtttctcgaa
gaggcgcagctggcttatcggctgatacgtgtagatatcagtaagggcgaccagttccgc
ccggagttcctgtcgatttcaccgaataataaaatcccggccatcgtcgaccacgttccc
gcggacggcggcgcgccgctggccctgtttgagtcaggcgaaatattgctgtatctggcg
gaaaaatccggaaagctgctcagcggcgagctgcgcgaacgccatgttaccctgcagtgg
ctgttctggcaggtgggcgggctggggccgatgcttgggcaaaaccatcattttaatcat
tttgcgcctcagccggtgccgtacgccattgagcgttatcaggttgagaccctgcggtta
tacaacgtgctgaataagcgccttgagcgctcgccgtggcttggcggcgagcactacagc
atagcggatatcgcctgctggccgtggatcaacgcccaccagcgccagcgtatcgacctc
gataacttcccggcggtgaagaactggtttgagcgcatcagccagcgtccggcaacggtt
ctggcgatgcagaaggcgcaagcttaa

DBGET integrated database retrieval system