KEGG   Komagataeibacter nataicola: B0W47_00275Help
Entry
B0W47_00275       CDS       T04737                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
kna  Komagataeibacter nataicola
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:kna00001]
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    B0W47_00275
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    B0W47_00275
Enzymes [BR:kna01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     B0W47_00275
Peptidoglycan biosynthesis and degradation proteins [BR:kna01011]
 Precursor biosynthesis
  Racemase
   B0W47_00275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(70158..71342)
Genome map
AA seq 394 aa AA seqDB search
MPDLPFPQPMASGWAPAGAGAALEIDLDAIAANYRLLDARTGAATCAAVVKADAYGLGAD
RVAPVLEQAGARVFFVAHLEEGIRLRPHVSPAARIFVLHGPMPGTEALFTHHALLPVLNS
MEQVARWRAHAAQAHKALPAALQVDTGMSRFGLSEGDVATLAQTPGLLDGIDTKLVMSHL
ACADTPENPANAMQRDRLRAMAARLPAAPWALSASSGIFLGPDYHFNLVRPGAALYGLAP
NAQAPNPLRPTVRLRARIVQRRAIGAGDSVGYGLTWHATGPRRIATLGIGYADGFLRSGA
NGGGCAWLGDYRLPILGRISMDSTTVDVNDVPESVLDAATHVDMIGPRRSVDDVAHDAGT
IGYEVLTALGSRFHRTYRQPVACDASPCQNKASV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacctgcccttcccccagcccatggcttcaggctgggcccctgccggtgcaggc
gctgcgctggaaatcgacctggacgccatcgccgccaattaccgcctgctcgatgcccgc
acgggcgccgccacctgcgccgccgtggtcaaggccgatgcctatggccttggggccgac
cgggtcgcccccgtgctggaacaggccggggcgcgggttttctttgtcgcccatctggaa
gaaggcatccgcctgcgcccgcatgtctcgccggctgcgcggatttttgtgctgcatggc
cccatgcccggcaccgaggcgctgttcacccatcacgccctgctgcccgtgctcaacagc
atggagcaggtggcacgctggcgcgcccatgcggcacaggcgcacaaagcgctgcccgct
gccctgcaggtggataccggcatgtcacgctttggcctgtcggagggggatgtggcgaca
ctggcacagaccccaggcctgcttgatggcatcgacacgaagctggtcatgagccacctc
gcctgcgctgatacgcccgagaaccccgccaacgccatgcagcgcgaccggctgcgcgcc
atggcggcccggctgcccgccgccccgtgggcgctttcggcctcgtcaggcatcttcctc
gggccggactatcatttcaacctcgtgcgccctggtgccgcgttgtacggccttgccccc
aatgcacaggcccccaacccgctgcgccccacggtcaggctgcgcgcccgcatcgtgcag
cgccgcgccattggggctggcgatagcgtgggctatggcctgacatggcacgccaccggc
ccgcggcggattgcaacgctgggcataggctatgccgatggcttcctgcgcagcggggca
aatggcggcggctgcgcgtggcttggtgactacaggctgcccatcctggggcgtatttcc
atggattccaccacggtggatgtcaatgacgtgcctgaaagcgtgcttgatgccgcgacg
catgtggacatgatcggcccgcgccgcagcgtggatgacgtggcccacgatgcaggcacc
atcggctacgaagtgctgaccgcactgggttcacgtttccatcgcacatatcggcagcct
gtcgcgtgcgatgcttctccctgccagaataaggcctccgtgtaa

DBGET integrated database retrieval system