KEGG   Klebsiella michiganensis E718: A225_2366Help
Entry
A225_2366         CDS       T02173                                 

Definition
(GenBank) Isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
koe  Klebsiella michiganensis E718
Pathway
koe00020  Citrate cycle (TCA cycle)
koe00480  Glutathione metabolism
koe01100  Metabolic pathways
koe01110  Biosynthesis of secondary metabolites
koe01120  Microbial metabolism in diverse environments
koe01130  Biosynthesis of antibiotics
koe01200  Carbon metabolism
koe01210  2-Oxocarboxylic acid metabolism
koe01230  Biosynthesis of amino acids
Module
koe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
koe_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:koe00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A225_2366
  Metabolism of other amino acids
   00480 Glutathione metabolism
    A225_2366
Enzymes [BR:koe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     A225_2366
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: AFN31960
LinkDB All DBs
Position
2503268..2504518
Genome map
AA seq 416 aa AA seqDB search
MESKVVVPAEGQKITLQNGKLNVPNNPIIPFIEGDGIGVDVTPAMLKVVDAAVEKAYKGE
RKISWMEVYTGEKSTQVYGQDVWLPAETLDLIREYRVAIKGPLTTPVGGGIRSLNVALRQ
ELDLYVCLRPVRYYQGTPSPVKHPELTDMVIFRENSEDIYAGIEWKADSAEADKVIKFLR
DEMGVKKIRFPEHCGIGIKPCSEEGTKRLVRAAIEYAITNDRDSLTLVHKGNIMKFTEGA
FKDWGYQLAREEFGGELIDGGPWLKIKNPNTGKEIVVKDVIADAFLQQILLRPAEYDVIA
CMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILSA
EMMLRHMQWFEAADLIVKGMEGAIAAKTVTYDFERLMEGAKLLKCSEFGDAIIANM
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagtagttccggcggaaggtcaaaaaatcaccctgcaaaacggcaag
ctgaacgtccctaataacccgattatcccgttcatcgaaggtgatggtatcggcgttgac
gtgactccggcgatgctgaaagtggttgatgctgccgttgagaaagcctataagggcgag
cgtaaaatttcctggatggaagtttacaccggtgaaaaatcgacccaggtttatggccag
gatgtctggctgcctgccgaaactcttgatctgattcgtgaatatcgtgttgctatcaaa
ggccctctgaccaccccagtcggcggcggcatccgttctctgaacgttgctctgcgtcag
gaactggacctctacgtttgcctgcgcccggttcgttattatcagggtaccccgagcccg
gttaagcatcctgaactgaccgatatggttatcttccgcgaaaactctgaagacatctac
gccggtatcgagtggaaagccgattctgctgaagcagataaagtgatcaaattcctgcgc
gatgaaatgggcgtgaagaaaattcgcttcccggaacattgcggtatcggcatcaagccg
tgctctgaagaaggcactaaacgcctggttcgcgccgccatcgaatacgctatcaccaac
gatcgcgattctctgactctggtgcacaaaggcaacatcatgaaattcaccgaaggcgcg
ttcaaagactggggttaccagctggcacgcgaagagttcggcggtgagctgattgacggc
ggcccgtggctgaagattaaaaacccgaacaccgggaaagagatcgtcgttaaagacgtt
atcgccgacgccttcctgcagcagatcctgctgcgtccggcggaatacgatgttatcgcc
tgtatgaacctgaacggtgactatatctctgacgccctggcggcgcaggttggcggtatc
ggtattgccccgggtgcgaacatcggtgacgagtgcgcgctgtttgaagccacccacggt
actgcgccgaaatatgccggccaggacaaagtgaacccaggttccatcatcctgtccgct
gagatgatgctgcgccatatgcagtggttcgaagccgcagacctgatcgtcaaaggcatg
gaaggcgctatcgccgccaagaccgtgacctatgacttcgaacgtctgatggaaggcgct
aaactactgaaatgtagcgagtttggcgacgcgattatcgcgaacatgtaa

DBGET integrated database retrieval system