KEGG   Klebsiella michiganensis E718: A225_4199Help
Entry
A225_4199         CDS       T02173                                 

Definition
(GenBank) putative glutathione S-transferase
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
koe  Klebsiella michiganensis E718
Brite
Enzymes [BR:koe01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     A225_4199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4437644..4438273
Genome map
AA seq 209 aa AA seqDB search
MIDFYYAPTPNGHKITLFLEEAQLAYRLIRVDIGKGEQFHPQFLAISPNNKIPAIVDHAP
ADGGGPLSLFESGAILLYLAEKTGKLLSGELRERHVTLQWLFWQVGGLGPMLGQNHHFNH
FAPQAVPYAIERYQVETQRLYGVLNRRLGESPWLGGNHYSIADIACWPWVNAHQRQRIDL
ANYPAVHNWFERIRQRPATVEALLKTEAH
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatttttactacgcacccactcctaatggccacaaaatcacgttattcctcgaa
gaagcgcagctggcgtatcgcctcatccgggtggatatcggcaagggggaacagtttcat
ccgcagtttctcgcgatctcacccaacaacaagatcccggcgatcgttgaccacgctccc
gccgacggtggtggcccattaagcctgttcgaatccggcgccatcctgctctatcttgct
gaaaaaactggaaaattactgagcggcgagctccgcgagcgccacgtcaccctacagtgg
ttattctggcaggtcggcgggttggggccgatgctcggacaaaatcatcacttcaaccac
tttgctccgcaggcggtgccttacgccattgagcgctatcaggtggaaacgcagcgcctg
tatggcgtgctcaatcggcgccttggcgagagtccctggcttggcggcaatcactacagc
atcgccgatatcgcctgctggccgtgggtgaatgcccatcagcgccagcgtatcgacctt
gccaattacccggcggtgcataactggtttgaacgcattcgccagcgcccggccaccgtt
gaagcgcttctgaaaacagaagcccattaa

DBGET integrated database retrieval system