KEGG   Klebsiella michiganensis KCTC 1686: KOX_04875Help
Entry
KOX_04875         CDS       T01681                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
kox  Klebsiella michiganensis KCTC 1686
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kox00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    KOX_04875
   00650 Butanoate metabolism
    KOX_04875
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KOX_04875
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KOX_04875
Enzymes [BR:kox01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     KOX_04875
Amino acid related enzymes [BR:kox01007]
 Aminotransferase (transaminase)
  Class III
   KOX_04875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1007712..1008977)
Genome map
AA seq 421 aa AA seqDB search
MKSSELNQRRQQATPRGVGVMCSYFVEKAENATLWDIEGNEVIDFAAGIAVLNTGHRHPK
IVAAVEQQLQAFTHTAYQIVPYESYVTLAERINELAPIDGPAKTAFFTTGAEAVENAVKI
ARAYTGRPGLITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVYHAVYPNAAHGITTA
DAMKSLERIFKADIAADQVAAIVLEPIQGEGGFNVAPPEFMQALRALCDTHGILLIADEV
QTGFARTGKLFAMQHYDVKPDLMTMAKSLAGGFPLSGVVGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIEEEQLCQRAERLGSHLKEVLNQARQSCPAIADVRGQGSMVAVEFND
PQTGEPSAEITRQIQQQAQENGLLLLSCGVYGNVIRFLYPLTILDAQFTKALDILARVLK
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagttcagaactgaatcagcgtcgccagcaggcgactccgcgcggcgtaggggtg
atgtgcagctactttgttgagaaagcggagaacgctacgctgtgggatattgaagggaat
gaggtgatcgatttcgccgccggcatcgcggtgctgaataccggccatcgccaccccaaa
atcgttgccgccgttgaacagcagctgcaggcctttacccacacggcttaccagattgtc
ccgtacgaaagctatgtcacgctggccgagcggattaacgaactggcgccgattgacggt
ccggcaaaaacggcgttctttaccaccggggcggaagccgttgaaaacgcggtgaaaatc
gcgcgcgcttataccggtcgtccggggttgattaccttcggcggcggcttccacggccgt
acgtttatgaccatggcgctgaccggcaaagtggcgccttacaagattggtttcggcccg
ttcccgggctcggtttatcacgccgtctaccctaacgccgcccatggcattaccaccgcc
gacgcgatgaagagcctggagcgcattttcaaagcggatatcgcggccgatcaggtggcg
gcgattgtgctggagccgattcagggggaaggcggctttaacgttgccccgcctgagttt
atgcaggcgctgcgcgcgctgtgcgatacccacggcattctgctgattgccgatgaagta
caaaccggctttgcgcgcaccggcaagctatttgcgatgcagcactatgatgtgaagcct
gacctgatgacgatggccaaaagcctggccggcggtttcccgctctccggcgtggtaggt
cgcgccgaggtgatggatgcgcctgcgccgggcggtctgggcggcacctatgccggtaac
ccgctggcggtcgcggcggcgcacgcggtgctggacgtgattgaagaagaacagctgtgc
cagcgcgctgagcgcttaggcagccatctgaaagaggtgctgaatcaggcgcgtcaaagc
tgcccggcgattgctgacgtacgcggccaggggtcgatggtggcggtagagtttaacgat
ccgcaaaccggcgagccgtcggcggagatcacccgtcaaatccagcaacaagcccaggag
aacggcctgctgctgctgagctgcggcgtctatggcaacgtcattcgcttcctctatccg
ttaacgattctggatgcgcagtttacgaaagcgctggatattctggcccgcgtgctgaag
ggctag

DBGET integrated database retrieval system