KEGG   Klebsiella pneumoniae 30660/NJST258_1: KPNJ1_01701Help
Entry
KPNJ1_01701       CDS       T03176                                 

Definition
(GenBank) Anaerobic glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
kpa  Klebsiella pneumoniae 30660/NJST258_1
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kpa00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    KPNJ1_01701
Enzymes [BR:kpa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     KPNJ1_01701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1625800..1627422)
Genome map
AA seq 540 aa AA seqDB search
MTGRLDSEVIIIGGGATGAGIARDCARRGLRTLLIERHDIATGATGRNHGLLHSGARYAV
TDNESARECISENRILRRIARHCIEPTNGLFITLPEDDLAWQQTFIDACQQAGIEATPLS
PQEALRREPAVNPTLLGAVQVPDGTIDPFRLTAANMLDAREHGAQILTGCEVTGLLRRGD
RVCGVQVYDRQLHQARTLYAGMVVNAAGIWGQRIAEYADLRITMFPAKGSLLILDHRINN
LVINRCRKPADADILVPGDTISLIGTTSMHIPYDEIDDNRVTAAEVDTLLREGEKLAPVM
GRTRILRAYSGVRPLVASDNDPSGRSVSRGIVLLDHAQRDGMEGFITITGGKLMTYRLMA
EWATDAVCRKLGNTTPCTTAEAPLPGSQEPTESTLQKIISLPTPLRGSAVYRHGDRTPSW
LGDSRQHRSLVCECEAVTAGEVKYAVENLAVNTLLDLRRRTRIGMGTCQGELCACRAAGL
LQRFNVTTPAQSLTQLSEFLNERWKGVQPIAWGDALRESEFTRWVYLGLCGLPQEHRDEV
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgacgggacgtcttgatagcgaggtcattatcatcggcggcggagcaaccggcgccggt
atcgcccgcgactgcgcccggcgcggattacgaacgctgctcattgagcgccatgatatc
gccaccggggcgaccggccggaatcatggactgctgcacagcggcgcccgctacgcggtg
accgacaacgaatccgcccgcgaatgcatcagtgagaaccgcattctgcgccgcatcgcc
cgccactgtattgaaccgaccaatgggctgtttatcaccctgcctgaagatgacctggca
tggcagcaaacctttatcgacgcctgtcagcaggctggcatagaggccacgccgctctcg
ccgcaggaagcgctgcgccgggagcccgccgtcaacccgacgctgctgggcgcggtgcag
gtcccggacggtaccatcgacccgtttcgcctcaccgcggccaatatgctcgacgcccgc
gaacacggcgcgcagatccttaccggctgcgaagtaacaggcctgctgcgccggggcgat
cgcgtctgcggcgtccaggtatacgaccgccaacttcaccaggcccgcactctgtacgcc
gggatggtggttaacgccgccgggatctgggggcagcgtattgcggaatatgccgacctg
cgcatcaccatgttcccggcgaagggatcgctgctgatcctcgatcatcggattaacaac
ctggtgatcaaccgctgccgtaagccggccgacgccgatattctggtgcccggcgatacc
atctcgctgatcggcactacctcaatgcatattccttatgacgaaattgacgacaaccgg
gtaacagcggcggaggtcgataccctgctccgcgaaggggaaaagctggcgccggtcatg
ggccgcacccggatcctccgcgcctactccggcgtccgcccgctggtggccagcgataac
gatcccagcgggcgcagcgtcagccgcggcatcgtcctgctcgaccatgcccagcgtgac
ggtatggaaggcttcattaccatcaccggcggcaagctgatgacctatcgcctgatggcc
gagtgggccaccgacgccgtctgtcgtaagctgggaaacaccaccccctgtaccacggcc
gaagccccgctgcccggttcacaggagccaacggaaagtaccctgcaaaagattatctcc
ctccccaccccgctgcgcggctcggccgtctaccgtcacggcgatcgcaccccgtcctgg
cttggcgacagccgccagcaccgtagcctggtctgcgaatgtgaagccgtcactgccggt
gaagtgaaatacgcggtggaaaacctggcggtcaacaccctgctcgacctgcgccgccgc
acccggattggcatggggacctgtcagggggaactctgcgcctgccgcgctgccggcctg
ctgcagcgctttaacgtcaccacgcccgcgcagtcgttaacccagctctcggaatttctc
aatgaacgctggaagggcgtgcagcccatcgcctggggcgatgcgctgcgcgaaagcgaa
ttcacccgctgggtctacctcggcctgtgcggattgccacaggagcaccgggatgaagtt
tga

DBGET integrated database retrieval system