KEGG   Klebsiella pneumoniae 342: KPK_0288Help
Entry
KPK_0288          CDS       T00772                                 

Definition
(GenBank) putative 4-aminobutyrate transaminase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
kpe  Klebsiella pneumoniae 342
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kpe00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    KPK_0288
   00650 Butanoate metabolism
    KPK_0288
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KPK_0288
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KPK_0288
Enzymes [BR:kpe01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     KPK_0288
Amino acid related enzymes [BR:kpe01007]
 Aminotransferase (transaminase)
  Class III
   KPK_0288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
315075..316340
Genome map
AA seq 421 aa AA seqDB search
MKSSELNQRRQQATPRGVGVMCNYFVEKAENATLWDIEGNEVIDFAAGIAVLNTGHRHPK
VVAAVADQLQAFTHTAYQIVPYESYVSLAERINDLAPIDGPAKTAFFTTGAEAVENAVKI
ARAYTGRPGLITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVYHGVYPNEAHGVTTA
DALKSLERIFKADIAPDQVAAIILEPIQGEGGFNVAPADFMQALRDLCDTHGILLIADEV
QTGFARTGKLFAMQHYEVKPDLMTMAKSLAGGFPLSGVVGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIAEEQLCQRAEQLGSHLQEVLNQARATCPAIVDVRGRGSMVAVEFND
PQTGEPSPEFTRLVQQKAQENGLLLLSCGVYGNVIRFLYPLTIPDAQFSKALDILARILK
S
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagctcagaactgaatcaacgtcgccagcaggcgacgccgcgcggcgtaggcgta
atgtgtaactactttgtcgagaaggcggaaaacgccacgctgtgggatatcgaaggcaat
gaggtgatcgatttcgccgccgggatcgccgtgttaaataccggtcaccgtcatccgaaa
gtggtcgccgcggtcgccgatcagctgcaggcgttcacccacaccgcctatcagattgtg
ccgtacgaaagttatgtttcgctggcggagcgtatcaacgatctggcgccaattgacggg
ccggcaaaaacggctttcttcaccaccggcgcggaagcggttgagaacgcagtgaaaatt
gcccgcgcttacaccggccgcccggggctgattactttcggcggcggcttccacggccgt
acctttatgaccatggccctcaccggtaaggtcgcgccctacaaaatcggcttcgggccg
ttcccgggatcggtgtatcacggcgtttatcccaatgaggcgcacggcgtgaccaccgcg
gatgcgctgaaaagcctggagcgcattttcaaagcggatattgcgccggaccaggtagcg
gccatcatcctcgagccgatccagggggaaggcggctttaacgtcgcgccggccgatttt
atgcaggcgctgcgcgatctgtgcgatacccacggtattctgctgatcgctgatgaagtg
cagaccggtttcgcccgcaccggcaagctgttcgctatgcagcactatgaggtgaaaccg
gatctgatgacgatggcgaaaagcctcgccggcggtttcccgctgtcgggcgttgtcggt
cgcgccgaggtgatggatgcgccagccccaggcgggctgggcggaacctatgccggtaac
ccgctggcggtggccgcggcgcacgcggtgctggatgtcattgccgaagaacagctgtgc
cagcgcgctgagcagttgggtagccatctgcaggaagtgctcaaccaggcgcgcgctacc
tgcccggcgatcgtggatgtccgtggccgggggtcgatggtggcggtggagtttaacgat
ccgcaaacaggcgagccgtcgccggagttcacccgccttgtgcaacagaaagcgcaggaa
aacggcctgctgctgctgagctgtggcgtctacggcaacgtgatccgcttcctgtatccg
ttgactatccccgacgcccagttctcgaaagcgctggatattctggcgcgcatcctgaag
agctaa

DBGET integrated database retrieval system