KEGG   Klebsiella pneumoniae KCTC 2242: KPN2242_16555Help
Entry
KPN2242_16555     CDS       T01982                                 

Definition
(GenBank) putative S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
kpo  Klebsiella pneumoniae KCTC 2242
Brite
Enzymes [BR:kpo01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     KPN2242_16555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C_2 GST_C GST_N_3 GST_N_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: AEJ99201
LinkDB All DBs
Position
3478121..3478750
Genome map
AA seq 209 aa AA seqDB search
MIDLYYAPTPNGHKITLFLEEAELAYRLIRVDIGKGEQFHPQFLAISPNNKVPAIVDHMP
ADGGAPLSVFESGAILLYLAEKSGKLLSGELRERYVTLQWLFWQVGGLGPMLGQNQHFSH
SAPQTVPYAIERFQVETQRLYGVLNQRLGCSPWLGGDHYSIADIAAWPWVNCHVRQRIDL
ANYPAVHNWYERIKQRPATAEAMLKIQLY
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatctttactatgcacccaccccaaacggccacaaaatcaccctgttcctcgaa
gaggcggagctagcctatcggctaattcgggtcgatatcggcaaaggggaacaatttcat
ccgcagtttctggcgatttcgccgaataataaagttccggctatcgtcgaccacatgcct
gctgacggcggggcgccgttgagcgttttcgagtcaggcgccatcctgctctatctggcg
gaaaaaagcggtaagctgctgagcggcgagctgcgggaacgctacgtcacgctgcagtgg
ctgttctggcaggtcggcgggctggggccgatgctggggcaaaatcaacatttttcccac
tccgcgccgcaaaccgtgccctacgctattgaacgttttcaggtggaaacccaacgactg
tatggggtgctaaatcagcgtctgggatgcagcccgtggcttggcggcgaccactacagt
atcgccgacatcgccgcctggccctgggtgaactgccatgtccgacagcgtatcgatctg
gcgaactatccggcggtgcacaactggtatgagcgcattaagcagcggccggcaacggcg
gaagcgatgttaaaaattcagctttattaa

DBGET integrated database retrieval system