KEGG   Klebsiella pneumoniae subsp. pneumoniae KPR0928: KPR0928_04940Help
Entry
KPR0928_04940     CDS       T03371                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
kpq  Klebsiella pneumoniae subsp. pneumoniae KPR0928
Pathway
kpq00250  Alanine, aspartate and glutamate metabolism
kpq00280  Valine, leucine and isoleucine degradation
kpq00410  beta-Alanine metabolism
kpq00640  Propanoate metabolism
kpq00650  Butanoate metabolism
kpq01100  Metabolic pathways
kpq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kpq00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    KPR0928_04940
   00650 Butanoate metabolism
    KPR0928_04940
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KPR0928_04940
   00280 Valine, leucine and isoleucine degradation
    KPR0928_04940
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KPR0928_04940
Enzymes [BR:kpq01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     KPR0928_04940
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     KPR0928_04940
Amino acid related enzymes [BR:kpq01007]
 Aminotransferase (transaminase)
  Class III
   KPR0928_04940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AIE27006
LinkDB All DBs
Position
complement(1040538..1041821)
Genome map
AA seq 427 aa AA seqDB search
MNSNKAMMARRSDAVPRGVGQIHPIFAERAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
QVVAAVEDQLKKLSHTCFQVLAYEPYLALCEKMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATGRSGAIAFTGAYHGRTHYTLSLTGKVNPYSAGMGLMPGHVYRALYPCALHGVSD
DEAIASIHRIFKNDAAPEDIAAIIIEPVQGEGGFYAASPAFMQRLRALCDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAADITTFAKSIAGGFPLAGVTGRAEVMDAIAPGGLGGTYAG
NPIACAAALAVLQIFEQENLLEKANQLGDTLRQGLLAIAEDHPEIGDVRGLGAMIAIELF
EEGDRSRPNARLTADIVARARDKGLILLSCGPYYNVLRILVPLTIEEAQIEQGLKIIADC
FSEAKQA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcaataaagcaatgatggcgcgtcgcagcgacgcggtcccgcgcggcgtcggc
cagatccaccctatcttcgccgaacgcgcggagaactgccgggtgtgggacgtggaaggc
cgggaatatctcgattttgccggcggtatcgcggtgctcaataccggccacctgcatccg
caggttgtcgccgccgtcgaagaccagctgaaaaagctgtcgcatacctgcttccaggtg
ctggcctatgagccttatctggcgctgtgcgaaaagatgaatcaaaaggtgcccggtgat
ttcgccaagaaaaccctgctggtcaccaccgggtcggaagcggtggagaacgcggtgaag
atcgcccgcgcggcaaccgggcgcagcggcgctatcgccttcaccggcgcctatcacggc
cgcacccattacaccctgtcgctgaccggcaaagtgaatccttactccgccggtatgggc
ttaatgccgggccatgtctatcgcgccctctacccatgcgcgctgcacggcgtcagtgat
gacgaggcgatcgccagcatccatcgcatcttcaaaaacgatgccgcgccggaagatatc
gccgccatcattattgagccggtgcagggtgaaggcgggttctatgccgcctccccggcc
tttatgcagcgcctgcgcgccctgtgcgacgagcacggcattatgctcatcgccgatgag
gtccagagcggcgcgggccgcaccggtaccctgttcgccatggagcagatgggcgtcgcg
gcggatatcaccaccttcgccaaatccatcgccggcggtttcccgctggcgggcgtcacc
ggccgcgcggaggtgatggacgccatcgcccccggcggactgggcggcacctacgccggc
aaccccatcgcctgcgccgccgccctggcggtattacagattttcgagcaggagaatctg
ctggaaaaagccaaccagctcggcgacaccctgcgccagggcctgctggcgatcgctgaa
gatcatccggagatcggcgacgtgcgcggtctgggggcgatgatcgccattgagctgttt
gaagagggcgaccgcagcaggccgaacgccaggctgacggcggatatcgtcgcccgcgcc
cgcgacaaaggcctgatcctgctctcctgcgggccgtactacaacgtgctgcgcatcctg
gtgccgctgaccatcgaagaggcgcagatcgagcaggggctcaagatcatcgccgactgc
tttagcgaggcgaaacaggcatag

DBGET integrated database retrieval system