KEGG   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432: KPR_2063Help
Entry
KPR_2063          CDS       T02793                                 

Gene name
glpA
Definition
(GenBank) highly similar to anaerobic glycerol-3-phosphate dehydrogenase subunit A from Escherichia coli O44:H18 strain 042 - EAEC (tr|D3H1A8)
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
kpr  Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
Pathway
kpr00564  Glycerophospholipid metabolism
kpr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kpr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    KPR_2063 (glpA)
Enzymes [BR:kpr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     KPR_2063 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_oxidored FAD_binding_2 DAO_C FAD_binding_3 NAD_binding_8 Pyr_redox_2 Thi4 HI0933_like 3HCDH_N Pyr_redox GIDA Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: CCI76293
UniProt: R4Y7H0
LinkDB All DBs
Position
complement(2153293..2154921)
Genome map
AA seq 542 aa AA seqDB search
MKMTGRIDSEVIIIGGGATGAGIARDCARRGLRTLLIERHDIATGATGRNHGLLHSGARY
AVTDNESARECISENRILRRIARHCIEPTNGLFITLPEDDLAWQQTFIDACQQAGIEATP
LSPQEALRREPAVNPTLLGAVQVPDGTIDPFRLTAANMLDAREHGAQILTGCEVTGLLRR
GDRVCGVQVYDRQLHQARTLYAGMVVNAAGIWGQRIAEYADLRITMFPAKGSLLILDHRI
NNLVINRCRKPADADILVPGDTISLIGTTSMHIPYDEIDDNRATAAEVDTLLREGEKLAP
VMGRTRILRAYSGVRPLVASDNDPSGRSVSRGIVLLDHAQRDGMEGFITITGGKLMTYRL
MAEWAADAVCRKLGNTTPCTTAEAPLPGSQEPTESTLQKIISLPTPLRGSAVYRHGDRTP
SWLGDSRQHRSLVCECEAVTAGEVKYAVENLAVNTLLDLRRRTRIGMGTCQGELCACRAA
SLLQRFNVTTPAQSLTQLSEFLNERWKGVQPIAWGDGLHESEFTRWVYLGLCGLPQEHRD
EV
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
ctgaagatgacgggacgtattgatagcgaggtcattatcatcggcggcggagcaaccggc
gccggtatcgcccgcgactgcgcccggcgcggattacgaacgctactcattgagcgccat
gatatcgccaccggggcgaccggccgtaatcatggactgctgcacagcggcgcccgctac
gcggtgaccgacaacgaatccgctcgcgaatgcatcagtgagaaccgcattctgcgccgc
atcgcccgccactgtattgaaccgaccaacgggctgtttatcaccctgcctgaagatgac
ctggcatggcagcaaacctttatcgacgcctgtcagcaggctggcatagaggccacgccg
ctctcgccgcaggaagcgctgcgccgggagcccgccgtcaacccgacgctgctgggcgcg
gtgcaggtcccggacggtaccatcgacccgtttcgcctcaccgcggccaatatgctcgac
gcccgcgaacacggcgcgcagatccttaccggctgcgaagtaacaggcctgctgcgccgg
ggcgatcgcgtctgcggcgtccaggtatacgaccgccaacttcaccaggcccgcactctg
tacgccgggatggtggttaacgccgccgggatctggggacagcgtattgcggaatatgcc
gacctgcgcatcaccatgttcccggcgaagggatcgctgctgatcctcgatcatcggatt
aacaacctggtgatcaaccgctgccgtaagccggccgacgccgatattctggtgcccggc
gataccatctcgctgatcggcactacctcaatgcatattccttatgacgaaattgacgac
aaccgggcaacagcggcggaggtcgataccctgctgcgcgaaggggaaaagctggcgccg
gtcatgggccgcacccggatcctccgcgcctactccggcgtccgcccgctggtggccagc
gataacgatcccagcgggcgcagcgtcagccgcggcatcgtcctgctcgaccatgcccag
cgtgacggtatggaaggcttcattaccatcaccggcggcaagctgatgacctatcgcctg
atggccgagtgggccgccgacgccgtctgtcgtaagctgggaaacaccaccccctgtacc
acggccgaagccccgctgcccggttcacaggagccaacggaaagtaccctgcaaaagatt
atctccctccccaccccgctgcgcggctcggccgtctaccgtcacggcgatcgcaccccg
tcctggcttggcgacagccgccagcaccgtagcctggtctgcgaatgtgaagccgtcact
gccggagaagtgaaatacgcggtggaaaacctggcggtcaacaccctgctcgacctgcgc
cgccgcacccggattggcatggggacctgtcagggggaactctgcgcctgccgcgctgcc
agcctgctgcagcgctttaacgtcaccacgcccgcgcagtcgttaacccagctctcggaa
tttctcaatgaacgctggaagggcgtgcagcccatcgcctggggcgatgggctgcacgaa
agcgaattcacccgctgggtctacctcggcctgtgcggattgccacaggagcaccgggat
gaagtttga

DBGET integrated database retrieval system