KEGG   Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1: VK055_3117Help
Entry
VK055_3117        CDS       T03418                                 

Gene name
tuf
Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
kpt  Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Brite
Translation factors [BR:kpt03012]
 Eukaryotic Type
  Elongation factors
   VK055_3117 (tuf)
 Prokaryotic Type
   VK055_3117 (tuf)
Mitochondrial biogenesis [BR:kpt03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    VK055_3117 (tuf)
Exosome [BR:kpt04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   VK055_3117 (tuf)
  Exosomal proteins of breast cancer cells
   VK055_3117 (tuf)
  Exosomal proteins of colorectal cancer cells
   VK055_3117 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3197758..3198942)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALE
GDAEWEAKIIELAGHLDTYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKETAKTTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGTIN
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagaaaagtttgaacgtacaaaaccgcacgttaacgtcggtactatcggccac
gttgaccatggtaaaacaacgctgaccgctgccatcactaccgtactggctaaaacctac
ggtggttccgctcgcgcattcgaccagatcgataacgcgccggaagaaaaagctcgtggt
atcaccatcaacacctctcacgttgaatatgacaccccgactcgccactacgcgcacgta
gactgcccgggccacgccgactatgttaaaaacatgatcaccggtgctgcgcagatggac
ggcgcgatcctggttgttgctgcgactgacggcccgatgccgcagactcgtgagcacatc
ctgctgggtcgtcaggtaggcgttccgtacatcatcgtgttcctgaacaaatgcgacatg
gttgatgacgaagagctgctggaactggttgagatggaagttcgtgaactgctgtctcag
tacgatttcccgggcgacgacaccccgatcgttcgtggttctgctctgaaagcgctggaa
ggcgacgcagagtgggaagcgaaaatcatcgaactggctggccacctggatacctatatc
ccggaaccagagcgtgcgattgacaagccgttcctgctgccgatcgaagacgtattctcc
atctctggtcgtggtactgttgttaccggtcgtgtagagcgcggtatcatcaaagtaggt
gaagaagttgaaatcgttggtatcaaagaaaccgcgaaaaccacctgtactggcgttgaa
atgttccgcaaactgctggacgaaggccgtgctggtgagaacgtaggtgttctgctgcgt
ggtatcaaacgtgaagaaatcgaacgtggtcaggtactggctaagccgggcaccatcaac
ccgcacaccaagttcgaatctgaagtgtacatcctgtccaaagacgaaggcggccgtcat
actccgttcttcaaaggctaccgtccgcagttctacttccgtactactgacgtgactggc
accatcgaactgccggaaggcgtagagatggtaatgccgggcgacaacatcaaaatggtt
gttaccctgatccacccgatcgcgatggacgacggtctgcgtttcgcaatccgtgaaggc
ggtcgtaccgttggcgcgggcgtggttgctaaagttctcggctaa

DBGET integrated database retrieval system