KEGG   Kineococcus radiotolerans: Krad_1009Help
Entry
Krad_1009         CDS       T00562                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
kra  Kineococcus radiotolerans
Pathway
kra00564  Glycerophospholipid metabolism
kra01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kra00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Krad_1009
Enzymes [BR:kra01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Krad_1009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 AlaDh_PNT_C GIDA
Motif
Other DBs
NCBI-ProteinID: ABS02497
JGI: Krad1009
UniProt: A6W6Q8
LinkDB All DBs
Position
complement(1266429..1268135)
Genome map
AA seq 568 aa AA seqDB search
MEIKALSPQARADALREMAEGELDVLVVGGGVVGTGAALDAVTRGLRTAMVEARDWASGT
SSRSSKLIHGGLRYLEMLDFALVHEALSERGLLRNKLAPHLVRPVPFLYPLSKRVTERPY
VGSGVALYDAMAISGGNNKGFPLHRHLTRKGVQREAPGIRKDAMVGAIQYYDGQVDDARH
TMTIARTAATYGALVANRTRVKEFVREGERVVGAVLVDLESGAEIRVKAKQVINATGVWT
DETQELVNARGQFKVRASKGIHLVVPRDRIQSKTGVILRTEKSVLFIIPWGRHWIIGTTD
TDWTMDKAHPAATSADIDYVLEHANSVLKSPLAREDVQGVYAGLRPLLSGESESTSKLSR
EHVVGHPVPGLVVVAGGKYTTYRVMAKDAVDVAVEGLDGKVPASTTENVPLVGAEGYHAL
WNQRHALAARAGIHVDHVEHLLNRYGSAIDEVLALIVADPTLGEVLPHADEYLKAEVVYA
ATHEGARHLDDVLARRTRISIETYDRGTETAELAADLVAGPLGWDDERRATEVRTYLQRV
AAERASQEQPDDASADAVRLQAPEIVPV
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
gtggagatcaaggcactgtcaccgcaggcacgtgcggacgcgctgcgggagatggcggaa
ggtgagctcgacgtcctcgtcgtcggcggcggggtcgtcgggacgggtgcggccctggac
gcggtgacccgcggtctgcggacggcgatggtggaggcgcgggactgggcgtcggggacc
tccagccgctcgtccaagctcatccacggtggcctgcgctacctggagatgctggacttc
gccctcgtgcacgaggcgctcagcgagcgcggcctgctgcgcaacaagctggccccgcac
ctggtccggcccgtcccgttcctctacccgctgtccaagcgggtcaccgagcgcccctac
gtggggtccggggtcgcgctgtacgacgccatggcgatctccgggggcaacaacaagggt
ttcccgctgcaccgccacctgacccgcaagggcgtccagcgggaggcccccggcatccgc
aaggacgccatggtcggggccatccagtactacgacggtcaggtggacgacgcccggcac
accatgacgatcgcccgcacggcggcgacgtacggggcgctcgtcgccaaccgcacccgt
gtcaaggagttcgtccgcgagggcgagcgcgtcgtcggcgcggtcctggtggacctggag
tccggggccgagatccgggtgaaggccaagcaggtcatcaacgccaccggcgtgtggacc
gacgagacgcaggaactggtcaacgcccgcgggcagttcaaggtccgcgcgtccaagggc
atccacctcgtcgtgccgcgcgaccggatccagtcgaagacgggcgtgatcctgcgcacc
gagaagtcggtcctcttcatcatcccgtggggccggcactggatcatcggcaccaccgac
accgactggacgatggacaaggcccacccggccgcgaccagcgccgacatcgactacgtc
ctcgagcacgccaactcggtgctgaagtccccgctggcccgcgaggacgtccagggcgtc
tacgccgggctgcgcccgctgctgtcgggggagtcggagtcgacctcgaagctgtcgcgc
gagcacgtcgtgggccaccccgtccccgggctggtcgtcgtcgccggcggcaagtacacg
acgtaccgggtgatggccaaggacgccgtcgacgtcgccgtggaggggctggacgggaag
gtccccgcctccaccaccgagaacgtcccgctcgtcggcgccgagggttaccacgcgctg
tggaaccagcggcacgcgctggcggcgagggccgggatccacgtcgaccacgtcgagcac
ctgctcaaccgctacggctcggcgatcgacgaggtcctcgcgctcatcgtcgccgacccg
accctgggcgaggtcctgccgcacgccgacgagtacctgaaggccgaggtcgtctacgcc
gcgacccacgagggcgcccgtcacctcgacgacgtcctggcccgccgcacccggatctcg
atcgagacctacgaccgcggcaccgagaccgcggaactcgccgcggacctcgtcgccggc
cccctcgggtgggacgacgagcgccgcgccaccgaggtccggacctacctgcagcgggtg
gccgccgagcgcgcctcgcaggagcagcccgacgacgcctccgccgacgcggtgcgcctg
caggccccggagatcgtgccggtctga

DBGET integrated database retrieval system