KEGG   Kocuria rhizophila: KRH_05770Help
Entry
KRH_05770         CDS       T00701                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
krh  Kocuria rhizophila
Pathway
krh00010  Glycolysis / Gluconeogenesis
krh00030  Pentose phosphate pathway
krh00051  Fructose and mannose metabolism
krh00052  Galactose metabolism
krh00680  Methane metabolism
krh01100  Metabolic pathways
krh01110  Biosynthesis of secondary metabolites
krh01120  Microbial metabolism in diverse environments
krh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:krh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KRH_05770
   00030 Pentose phosphate pathway
    KRH_05770
   00051 Fructose and mannose metabolism
    KRH_05770
   00052 Galactose metabolism
    KRH_05770
  Energy metabolism
   00680 Methane metabolism
    KRH_05770
Enzymes [BR:krh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     KRH_05770
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     KRH_05770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: BAG28924
NITE: KRH_05770
UniProt: B2GIH5
LinkDB All DBs
Position
complement(631999..633030)
Genome map
AA seq 343 aa AA seqDB search
MRIGLMTSGGDCPGLNAVIRGAVLHGIKSFGHDFVGFRDGWRGVVEGDIMELPRQSVRGL
ARQGGTILGTSRTNPFDGPQGGPENIAKVLEANGIDAVVAIGGEGTLAGAKRLADAGLPV
VGVPKTIDNDLQATDYTFGFDTAVSIATDAMDRIRTTGESHHRCMVAEVMGRHVGWIALH
SGMAAGAHAILIPEFRESMEQVSEWVREVHDRGRSPLVVVAEGFIPDNREEAIAGKGVEA
SGRPRLGGIGEYVTHEIEDITGIETRNTILGHIQRGGAPTGFDRVLATRLGIAAVTMASE
QQWGKMCALRGTDVVRVDFAEALDGLKAVPRDRYDEAKELFGR
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcgggcttatgaccagcggcggggactgccccggactcaacgcggtgatccgc
ggtgcggtgctgcacggcatcaaatccttcggccacgacttcgtgggcttccgggacggc
tggcgcggtgtggtggagggcgacatcatggagctgccccgccagagcgtgcgcgggctc
gcccgccagggcggcaccatcctgggcacctcccgcaccaacccgttcgacgggccccag
ggcgggccggagaacatcgccaaggtgctcgaggccaacggcatcgacgccgtggtggcc
atcggcggcgagggcaccctggccggcgccaagcgcctcgcggacgccgggctgcccgtg
gtgggcgtgcccaagaccatcgacaacgatctccaggccacggactacacgttcggcttc
gacaccgcggtctccatcgccacggacgccatggaccgcatccgcaccaccggcgagtcc
caccaccggtgcatggtggcggaggtgatgggccgccacgtggggtggatcgccctgcac
tccggcatggccgcgggcgcccacgcgatcctgatccccgagttccgcgagtccatggaa
caggtctccgagtgggtccgcgaggtccacgaccgcggccgctccccgctcgtggtggtg
gcggagggcttcatcccggacaaccgggaggaggccattgccggcaagggcgtggaggcg
tccggtcgtccgcgcctgggcgggatcggcgagtacgtgacgcacgagatcgaggacatc
acgggtatcgagacccgcaacaccatcctgggccacatccagcgcggcggcgcgcccacg
ggcttcgaccgtgtgctggccacgcgcctgggcatcgccgcggtcaccatggcctccgag
cagcagtggggcaagatgtgcgcgctgcgcggcacggacgtggtgcgcgtggacttcgcc
gaggccctcgacggtctcaaggcggtcccgcgcgaccgctacgacgaggccaaggagctc
ttcggccgctga

DBGET integrated database retrieval system