KEGG   Kosakonia sacchari: C813_04670Help
Entry
C813_04670        CDS       T03601                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ksa  Kosakonia sacchari
Brite
Enzymes [BR:ksa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     C813_04670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2711869..2712450
Genome map
AA seq 193 aa AA seqDB search
MSFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLIKGSAFEGKSLEEIVKSS
EGGVFNNAAQVWNHTFYWNCLAPNAGGEPAGELAAAIAKSFGSFAEFKAQFTDAAVKNFG
AGWTWLVKKADGALAIVSTSNAGTPLTSDATPLLTVDVWEHAYYIDYRNARPNYLEHFWA
LVNWSFVAKNLAA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttgaattacctgcattaccgtatgcaaaagacgccctggcgccgcatatctca
gccgaaacgctggaataccactatggtaaacatcatcagacgtatgtcaccaacctcaac
aacctgatcaaaggcagcgcttttgaaggtaaatctctggaagagattgtgaaaagcagc
gaaggcggcgtgttcaacaatgccgcccaggtctggaaccataccttctactggaactgc
ctggctccgaatgctggcggtgaaccggctggtgagctggcggcggctatcgccaaatcc
ttcggcagctttgccgaattcaaagcgcaattcaccgatgctgcggttaaaaacttcggt
gctggctggacgtggctggtgaaaaaagcggatggcgcattagccattgtttcaacgtct
aatgcgggtacgccgctgacaagcgacgcaaccccgctgttaaccgtcgatgtgtgggaa
catgcgtattacatcgattatcgtaatgcgcgtccgaactacctcgaacatttctgggcg
ctggtaaactggtcattcgtggccaaaaatttagcggcataa

DBGET integrated database retrieval system