KEGG   Kitasatospora setae: KSE_24430Help
Entry
KSE_24430         CDS       T01648                                 

Gene name
kynU
Definition
(GenBank) putative kynureninase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
ksk  Kitasatospora setae
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ksk00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    KSE_24430 (kynU)
Enzymes [BR:ksk01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     KSE_24430 (kynU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
LinkDB All DBs
Position
2711715..2712944
Genome map
AA seq 409 aa AA seqDB search
MTPTRAQCAARDAADPLHALRAEFDLPAGVLYLDGNSLGALPRRTPGHLARVVADEWGVG
LIRSWNEAGWFHRPGRLGDRLGAHLLGAAPGQVVVCDSTSVNLFKVLGAALRLRPGRPAL
LAERHAFPTDLYVADGVGALRPGTRTVLLDSAAQLDAVLDAGTAAVLLSHVDYRTGELLD
MAGLTARIHAAGALAVWDLCHTAGALPVELDAAGADFAVGCGYKYLNGGPGAPAFLYAAA
RHQEAARQPLTGWFGHARQFDFEPGYRPAEGVTRFLTGTPPILGLAALEAALQVWELADP
TAVRAKSLELTDLFLELTADLDVEPVTPREHARRGSQVALRHPDGYAVVQALIARGVIGD
FRAPDLMRFGFTPLYLSRADVHDAAGALREVLASGEWRDGRFARRGEVT
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtgacccccacccgtgcgcagtgcgcggcccgcgacgccgccgacccgctgcacgccctg
cgcgccgagttcgacctgcccgccggggtgctgtacctcgacggcaactcgctgggcgcg
ctgccccgccgcaccccgggccacctggccagggtggtggcggacgagtggggcgtcggc
ctgatccggtcctggaacgaggcgggctggttccaccggcccggccggctcggcgaccgg
ctcggcgcccacctgctgggcgccgcgccggggcaggtggtggtctgcgactcgacctcg
gtcaacctgttcaaggtgctgggcgcggccctgcggctgcgtccgggccgcccggcactg
ctggccgagcggcacgccttcccgaccgacctgtacgtcgccgacggcgtgggcgcgctg
cgtcccggcacccgcaccgtactgctggactccgccgcgcagctggacgccgtgctggac
gcgggcaccgccgccgtcctgctctcgcacgtcgactaccgcaccggcgagctgctggac
atggccggcctgaccgcccggatccacgcggccggggcgctggcggtctgggacctgtgc
cacacggcgggcgcgctgccggtcgaactggacgcggcgggcgccgacttcgcggtcggc
tgcggctacaagtacctcaacggcggcccgggcgcgcccgccttcctgtacgcggcggcc
cgccaccaggaggccgcccggcagccgctgaccggctggttcgggcacgcccggcagttc
gacttcgagccgggctaccggcccgccgagggcgtcacccggttcctgaccggcacgccg
ccgatcctgggcctggccgcgctggaggcggcgctgcaggtctgggagctggccgacccg
acggccgtccgcgccaagagcctggaactcaccgatctgttcctggagttgaccgccgac
ctggacgtcgagccggtcaccccgcgcgagcacgcccggcgcggcagccaggtcgcgctg
cgccacccggacggctacgcggtggtccaggcgctgatcgcccgcggcgtgatcggcgac
ttccgcgcccccgacctgatgcgcttcggtttcaccccgctctacctctcccgcgccgac
gtgcacgacgcggcgggcgcgctgcgcgaggtgctggcgagcggcgagtggcgcgacggg
cggttcgcccgccgcggcgaggtgacctga

DBGET integrated database retrieval system