KEGG   Klebsiella variicola At-22: Kvar_0276Help
Entry
Kvar_0276         CDS       T01170                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
kva  Klebsiella variicola At-22
Pathway
kva00250  Alanine, aspartate and glutamate metabolism
kva00410  beta-Alanine metabolism
kva00640  Propanoate metabolism
kva00650  Butanoate metabolism
kva01100  Metabolic pathways
kva01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kva00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Kvar_0276
   00650 Butanoate metabolism
    Kvar_0276
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Kvar_0276
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Kvar_0276
Enzymes [BR:kva01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Kvar_0276
Amino acid related enzymes [BR:kva01007]
 Aminotransferase (transaminase)
  Class III
   Kvar_0276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ADC56207
JGI: Kvar_0276
LinkDB All DBs
Position
304908..306173
Genome map
AA seq 421 aa AA seqDB search
MKSSELNQRRQQATPRGVGVMCNYFVEKAENATLWDIEGNEVIDFAAGIAVLNTGHRHPK
VVAAVADQLQAFTHTAYQIVPYESYVSLAERINDLAPIDGPAKTAFFTTGAEAVENAVKI
ARAYTGRPGLITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVYHGVYPNAAHGVTTA
DALKSLERIFKADIAPDQVAAIILEPIQGEGGFNVAPADFMQALRDLCDTHGILLIADEV
QTGFARTGKLFAMQHYEVKPDLMTMAKSLAGGFPLSGVVGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIAEEQLCQRAEQLGSHLQEVLNQARATCPAIVDVRGRGSMVAVEFND
PQTGEPSPEFTRQVQQKAQENGLLLLSCGVYGNVIRFLYPLTIPDAQFSKALDILARILK
S
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagctcagaactgaatcaacgtcgccagcaggcgacgccgcgcggcgtaggcgta
atgtgtaactactttgtcgagaaggcggaaaacgccacgctgtgggatatcgaaggcaat
gaggtgatcgatttcgccgccgggatcgccgtgttaaataccggtcaccgtcatccgaaa
gtggtcgccgcggtcgccgatcagctgcaggcgttcacccacaccgcctatcagattgtg
ccgtacgaaagttatgtttcgctggcggagcgtatcaacgatctggcgccaattgacggg
ccggcaaaaacggctttcttcaccaccggcgcggaagcggttgagaacgcagtgaaaatt
gcccgcgcttacaccggccgcccggggctgattactttcggcggcggcttccacggccgt
acctttatgaccatggccctcaccggtaaggtcgcgccctacaaaatcggcttcgggccc
ttcccgggctcggtgtatcacggtgtctacccgaatgcggcgcacggcgtgaccaccgcg
gatgcgctgaaaagcctggagcgcattttcaaagcggatattgcgccggatcaggtagcg
gccattatcctcgagccgatccagggggaaggcggctttaacgtcgcgccggccgatttt
atgcaggcgctgcgcgatctgtgcgatacccacggtattctgctgatcgctgatgaagtg
cagaccggtttcgcccgcaccggcaagctgttcgctatgcagcactatgaggtgaaaccg
gatctgatgacgatggcgaaaagcctcgccggcggtttcccgctgtcgggcgttgtcggt
cgcgccgaggtgatggatgcgccagccccaggcgggctgggcggaacctatgccggtaac
ccgctggcggtggccgcggcgcacgcggtgctggatgtcattgccgaagaacagctgtgc
cagcgcgctgagcagttgggtagccatctgcaggaagtgctcaaccaggcgcgcgctacc
tgcccggcgatcgttgatgtccgtggccgggggtcgatggtggcggtggagtttaacgat
ccgcaaactggcgagccgtcgccggagttcacccgccaggtgcaacagaaagcgcaggaa
aacggcctgctgctgctgagctgtggcgtctacggcaacgtgatccgcttcctgtatccg
ttgactatccccgacgcccagttctcgaaagcgctggatattctggcgcgcatcctgaag
agctaa

DBGET integrated database retrieval system