KEGG   Klebsiella variicola DX120E: KR75_13085Help
Entry
KR75_13085        CDS       T03531                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
kvd  Klebsiella variicola DX120E
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kvd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    KR75_13085
   00650 Butanoate metabolism
    KR75_13085
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    KR75_13085
   00280 Valine, leucine and isoleucine degradation
    KR75_13085
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KR75_13085
Enzymes [BR:kvd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     KR75_13085
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     KR75_13085
Amino acid related enzymes [BR:kvd01007]
 Aminotransferase (transaminase)
  Class III
   KR75_13085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
4429004..4430287
Genome map
AA seq 427 aa AA seqDB search
MNSNKAMMARRSDAVPRGVGQIHPIFAERAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
QVVAAVEDQLKKLSHTCFQVLAYEPYLALCEKMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATGRSGTIAFTGAYHGRTHYTLSLTGKVNPYSAGMGLMPGHVYRALYPCALHGVSD
DEAIASIHRIFKNDAAPEDIAAIIIEPVQGEGGFYAASPAFMQRLRALCDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAADITTFAKSIAGGFPLAGVTGRAEVMDAIAPGGLGGTYAG
NPIACAAALAVLQIFEQENLLEKANQLGDTLRQGMLAIAEDHPEIGDVRGLGAMIAIELF
EEGDRSKPNARLTADIVARARDKGLILLSCGPYYNVLRILVPLTIEEAQIEQGLKIIADC
FTEAKQA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcaataaagcaatgatggcgcgtcgcagcgatgcggtcccgcgcggcgtcggc
cagatccaccctatcttcgccgaacgcgcagagaactgccgggtgtgggacgtcgaaggc
cgggaatatctcgattttgccggcggtatcgcggtgctcaataccggccatctgcatccg
caggttgtcgccgccgtcgaagaccagctgaaaaagctgtcgcatacctgctttcaggta
ctggcctacgagccttacctggcgctgtgcgaaaagatgaaccagaaggtgcccggtgat
ttcgccaagaaaaccctgctggtcaccaccgggtcggaagcggtggagaacgcggtgaaa
atcgcccgcgcggcaaccgggcgcagcggtaccatcgccttcaccggcgcctatcacggc
cgtacccattacaccctgtcgctaaccgggaaagtgaacccgtactccgccggtatgggc
ttaatgccgggccacgtctatcgcgccctctacccgtgcgcgctgcacggcgtcagcgat
gacgaggcgatcgccagcatccatcgcatcttcaaaaacgatgccgcgccggaagatatc
gccgccatcattatcgagccggtgcagggtgaaggcggattctatgccgcctccccggcc
tttatgcagcgcctgcgcgccctgtgcgacgagcacggcattatgctcatcgccgatgag
gtccaaagcggcgcgggccgtaccggcacgctgttcgccatggagcagatgggcgtggcg
gcggatatcaccaccttcgccaaatccatcgccggcggtttcccgctggcgggcgtcacc
gggcgggcggaggtgatggatgccatcgcccccggcggactcggcggcacctacgctggc
aaccccatcgcctgcgccgccgccctggcggtattacagattttcgagcaggagaacctg
ctggaaaaagccaaccagcttggcgacaccctgcgccagggcatgctggcgattgcagaa
gatcatccggagatcggtgacgttcgcggcctgggggcgatgatcgccattgagctgttt
gaagagggcgaccgcagcaagcctaacgccagactgacggcggatatcgtcgcccgcgcc
cgcgacaaaggcctgatcctgctctcctgcgggccgtactacaacgtgctgcgcatcctg
gtgccgctgaccatcgaagaggcgcagatcgagcagggtctcaagatcatcgccgactgc
tttaccgaggcgaaacaggcatag

DBGET integrated database retrieval system