KEGG   Candidatus Liberibacter asiaticus gxpsy: WSI_01005Help
Entry
WSI_01005         CDS       T02506                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
laa  Candidatus Liberibacter asiaticus gxpsy
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:laa00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    WSI_01005
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    WSI_01005
Enzymes [BR:laa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     WSI_01005
Peptidoglycan biosynthesis and degradation proteins [BR:laa01011]
 Precursor biosynthesis
  Racemase
   WSI_01005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
214613..215659
Genome map
AA seq 348 aa AA seqDB search
MNALSGNARTAAVVKDNAYGLGCEKIAPALYNAGVQDFFVTSVEEGVKLRLYTPQARIFV
LYGIHPGQEKIIFDTNLIPVISSVPQLTFYSKLMSCGVSHPYALQVDTGFNRLGLSLQEA
LDFTHNSFNKKLGQLSLIISHLACADDPSSHVNSVQLERFRTLISHYKGIEASLASSSGI
LLGPNYHFQLTRPGISLYGGTDKINKSHPMQTVVTAEARIILIRKALAGELVSYGGQKKL
TRDSLIAVAAIGYADGYPLTLSGLDSEHSPSVFLGGKGFIKGYMVPILGKITMDMTMFDI
TDSLSIEVGDYIQIFGPDIKLDDVALASGTTNYDLLVRIGTRYAKFYT
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcactttctggtaacgcacgaacagcagcagtagtgaaggacaatgcatatggg
ttgggttgtgaaaagatagctccagccctctacaatgctggagtgcaagatttttttgtg
actagtgtagaagaaggagtaaaacttcgtctatataccccacaagcaagaatttttgtt
ttatatggtatacatccaggacaagaaaaaattatatttgacacaaatctcatacctgtt
atctcttctgttcctcaactgactttttattcaaagttaatgtcttgtggcgtttcacat
ccctacgctttacaagttgatacaggcttcaataggttaggactctctctacaagaagca
ttagattttacacacaattcttttaataaaaaattaggtcagttatctctcatcataagt
catcttgcttgtgctgatgacccgagttctcatgttaattctgtgcaattagaaagattt
cgtactcttatctcacattataagggaatagaagcaagtttagcctcttcatcaggaatt
ttactcggtccaaattatcattttcaattaactcgccctggaatatccctatatggcgga
actgataaaatcaataagtcgcatcctatgcaaactgttgtcactgcagaagcacgtatt
attctcatccgcaaagcattggcaggagaattagttagctatggaggacaaaaaaaatta
acacgcgatagtctgatagccgttgcagccattggatatgccgatggctatcctttaacc
ctttctggattagattcagaacacagtccatctgtatttctaggagggaaaggatttatc
aaaggttatatggttcccattttagggaaaataacaatggacatgacaatgtttgacatt
accgattctcttagcatagaagtaggagattatatccagatttttggacctgatataaaa
ttagatgatgtagcccttgcttctggaactactaattatgatcttcttgtgagaattgga
acgcgttatgcaaaattttatacataa

DBGET integrated database retrieval system