KEGG   Lachnoclostridium sp. YL32: A4V08_16030Help
Entry
A4V08_16030       CDS       T04430                                 

Definition
(GenBank) hypothetical protein
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
lacy  Lachnoclostridium sp. YL32
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:lacy00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    A4V08_16030
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    A4V08_16030
Enzymes [BR:lacy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     A4V08_16030
Bacterial toxins [BR:lacy02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   A4V08_16030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3473275..3479172)
Genome map
AA seq 1965 aa AA seqDB search
MKKRIWHKLFCLLLSVSMLTTVLPLSAIAAEIQDGGPPVSDASAPDGENAGDDGISLLSD
NDLKISGYTQVTELPSEGLSGKYLIIAPYNGQYYMLYPGGTNGGNAVKNSARLVVGSDGT
ATGYQVGYGSIYGTATTATDFTAAENTITKNSDGTYSVTATGPSNAQYVLCNSSGTLTPV
YSTASTSSVDIQASSTNGYLNVINHARTSYVVFYTTWMNFAQSGELKDDSIGDMMFFRND
DAEVEDGSGDGSEETDGLPGYTQVTRLSQIKPDKKYLIVAQAPDKTFYALYLNEAGADKG
PGSNAYPECTANLTISGGKVTAVSAANTATSIKMDDLHVTITQNSETGKYTIKNNTHSLA
LTSNEMYAAASNATEFECTFVGTGSRFQIYNRGPNRYLTFNVKGSPDSHYPDKANTGFSG
WSDPQTEYIPVYLYVEGELDVEPGMNLFNMLSGDQIGGGNATVNDPDGQNSWVFTGGRAA
QGSFADVKGARTWAGHFEEYVRYTHAKALQPSGESNTPYFQRHVINAAYGNQTLAEIVST
FDDRIAALKPRAVVYLVGENDGTDSISTNLNNLISKSLGLKNGKGMIVIATLTDTDKAAV
DEVVNALKGEQKPNVLSVQFNLTTGEKTGGYPNASGHFAMAKQLTNAIMGTNVSSAANWP
YGAINNSVLASGFPNKTGVTVAHDDYGTPDTLTTPQQTVKELVEDEETPATWLFMGDSIT
HGSAWTGGYDTLAQLFEKFVKDDLDRPQDLVINAGSSGATTASTLSDLNRRLVKYNPDVV
VLMLGTNDAAGKVSENTYKANLRTILDKIMDKGAVPVLRTPPPTSRDGYAIADYAQYIRD
VANETKYADKVILVDQYARWTSMNWNAVFTRDDLHPDEAGHLWFAHQLIQELGLWDSKYE
ICKLEYVEMKEQEKIEIPGYTQVTNVSQLSDDKGYLIVSQDAQGNLYALYPSEEGKTLGS
GALPKPNDENDGARTASLTVSEDTVTAKWLKNNDKLTMEKLLFTIKRGENNGYIFTSFNG
RHLNMANNMFTQGSVALTVTSRAAAPGAFEIKNPNDGGGNPRVLDFSKNGDPNAFIGSDG
STWGTDFWCPRSAKMSIYLFASDTAKVPTAKESIETLIQEDIEGLLEEDYTSASWARLKT
ALAAAWAELKAYNADSMNGNEPQFVTARDNLQSAYDNLQRKPVIPTVPAGATKIENWKNM
VPASGSTKNEPFASGTGGSTKFRIPAIITLKHQTGANASKNGRLLAAIDARWNHVGDACG
LDTIVSYSDDNGGNWNYNFPNYFGDSTNAYATYGTAFIDPVLVEGNDGAIYMMVDLWPGG
VALNTAPMRPASATGYVEINGTKRLALYTSPVTGSQSDTNYSYYVGGFEDGYAPVYEPTE
GKADTFAGYYVDEYYYLYHTEGEFAEKTPANDKIYCQRLGNSEWVQQNVFFYNASLHVRN
ASYLWIVKSTDGGETWSKPQMINDQVRTGADQFYGVGPGAGLCMDNGMILLPVYIWPDEH
AGFIYSEDNGATWHRSPTYATNTSRDSSESCLIQIDDTTVRHFYRDSWSNSMVVRYTDHT
WNGTSWTTGSVTRVEGAPRWGACQLSAIKYSKKVDGKDLILYSAPSSTSNRTKGVIHAFL
VNDDKTMTLYNTYSVNGDGVYAYSSLTETADGNIALLYESTNDAVIFEIIPITDIIPSKN
TSNGNGSSSPSTTTTVEKNPGGSTTTTVTDNQTGAVTVTTENPDGSKNVVETKKDGTVTE
TKIDAQGGKAEKVSVPDEGITVTDPSGEILVKLELPSTIPELEQKFADVPENHWAEQGIL
DMAALGVIHGVSNDRYDMNGPIKRADMATMLFCLSNVDTRGNAQFSDVPDDAYYAESVAW
ASEAGVVRGVGNGQFLPENASTREELAVMLYRYAMLLKLDTTVSTDLLNAFSDGSQTHSW
AEDSLAWCVKNHIIQGKDGEILDPRNNATRAEAAVMLQRFLKLIA
NT seq 5898 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaggatatggcacaaacttttctgtctcctgctatctgtctccatgcttacc
acggtcttgcccttgtccgcaatcgcggcagagatccaggatggcgggccgcctgtcagc
gacgcgtctgcgccggacggcgaaaacgcaggggatgatgggatttccctgctttccgac
aatgatctcaaaatttcgggctatacccaggtaaccgagctcccctccgaggggctttcg
ggcaaatacctgattatcgccccttataatggccagtactatatgctctaccccggcggg
acaaatggtggaaacgccgtcaaaaactccgcccggctggtggtgggcagtgacggcacg
gccaccggctaccaggtcggctatggcagcatctatggcaccgccacgacagcgaccgac
ttcaccgccgcggaaaataccatcaccaaaaacagcgacggcacctattccgttacggcc
actggaccgagcaatgcccagtatgtcctgtgcaattccagtggtacgcttacgccggtc
tactccaccgcttccaccagctctgtggacattcaggcctccagcaccaacggttatctg
aacgtgataaaccatgcgcgcacttcttatgttgttttttacacaacctggatgaatttt
gcccagagcggtgagctcaaagatgactctatcggcgatatgatgttcttccggaatgat
gatgctgaggttgaggatggatccggggatggatccgaggagacagacggccttccgggc
tacacgcaggtgacccggctgagccagatcaagccggacaaaaagtatctgattgttgcc
caggcccctgacaaaacattctatgccctctatctcaacgaggccggcgcggacaaaggc
cccggttcaaatgcctacccggaatgcaccgcgaatttgaccatttccggcggcaaagtg
accgcggtcagcgccgcaaatacagctacttccataaagatggacgaccttcatgttacc
atcacgcagaactctgagaccgggaagtatacaattaaaaacaatacccattccctcgcg
ctgacgtcaaacgaaatgtacgccgctgcgagtaatgctaccgaatttgagtgcaccttt
gttgggactggaagccgcttccagatatacaacagaggcccaaatcgttaccttacgttt
aatgtaaagggctcgcctgactcccattaccccgataaggcaaataccggctttagcggc
tggagcgatccacagaccgaatacatccccgtttacctctacgttgagggcgagctggac
gttgagccgggcatgaacctcttcaacatgctttccggcgaccagatcggcggcggtaac
gccacggtcaacgacccggacggccagaactcctgggtctttaccggcggccgcgccgcc
cagggtagctttgccgacgtcaagggcgcgcgcacctgggccggacactttgaggagtat
gtccgctacacccacgccaaggcgctccagcccagcggcgaaagcaacacgccctacttc
cagcgccatgtcatcaacgccgcctacggcaatcagacccttgcggagatcgtcagcacc
tttgacgaccgcatcgctgcgctgaaacccagggccgtcgtctacttggtgggcgagaac
gatggcaccgacagcatctccaccaacctgaacaacctgattagcaagtctctggggctg
aaaaacggcaagggcatgatcgtcattgcgaccctcaccgataccgacaaggcggcggtg
gacgaggtggtcaatgcccttaagggcgagcagaagcccaatgtgctgagcgtgcagttc
aacctcaccactggggagaaaaccggcggctatcccaacgccagcggccattttgccatg
gccaagcagctgaccaacgccatcatgggcacaaacgtttccagcgccgccaactggccc
tacggcgcgatcaacaacagcgtcctggcttcgggcttccccaataagaccggcgtgacc
gtcgctcacgacgactacggaacccccgatacgctgaccacccctcagcaaacggtcaaa
gagctggtagaagacgaggagacccccgcgacctggctgtttatgggcgactccatcacc
cacggctcggcctggaccggcggctatgacaccctggcccagctctttgaaaagttcgtc
aaggacgacctggaccgcccccaggacctcgtgatcaacgccggttcctccggcgccacc
accgcgtccaccctcagcgacctgaaccgccgtctggtgaagtataaccccgacgtggtc
gtgctcatgctgggcaccaacgacgccgccggcaaggtctctgaaaacacctacaaagcc
aatctccgcaccattctggacaaaattatggacaagggcgccgtccccgtcctgcgcacc
ccgccccccacctcccgcgacggttatgccattgcggactacgcccaatacatccgggac
gtggccaatgaaacgaagtatgcggacaaggtcatcctggtggatcagtacgcccggtgg
acctccatgaactggaacgcggtgttcacgcgggatgaccttcatcccgacgaggcgggc
cacctctggtttgcccaccagctcattcaggagctgggcctgtgggacagcaagtacgaa
atctgcaagctggaatacgtggagatgaaggagcaggagaagatcgagatccccggctac
acccaggtcaccaacgtgagccagttgagtgatgacaagggctatctcatcgtcagccag
gacgcgcagggcaatctctacgccctctacccctccgaggagggcaagaccctggggtcg
ggcgctctgccaaagcccaacgatgagaacgacggcgcccgcacggccagcctgaccgtg
agcgaggataccgtcaccgccaaatggctgaagaacaacgacaagctgactatggaaaag
ctgctgttcaccattaaacgcggcgagaataacggctacatattcacatccttcaacggc
cgccacctgaatatggcgaacaatatgttcacccaaggttccgtggcgctcaccgtaacc
agccgcgccgctgctccgggcgcatttgagatcaagaaccccaacgatggaggcggtaac
ccccgcgtgctggacttcagcaaaaacggcgaccccaacgctttcattgggagcgacggg
agcacatgggggaccgacttctggtgtcccagaagcgcgaagatgtccatctacctcttt
gccagcgacaccgccaaggtccccaccgcaaaagagtccatcgagacgctgatccaggag
gatattgagggtctgctggaggaggactacaccagcgcatcctgggctaggctcaagacg
gccctggccgccgcatgggctgagctgaaagcgtacaatgcagattccatgaacggcaac
gagccgcagtttgtcacggcccgggacaatctgcagagcgcctacgacaacctccagcgc
aagcccgtcatccccaccgtgcccgccggcgccacaaagattgagaactggaaaaatatg
gtcccggcatccggctccacaaagaacgagccttttgcctccggtaccggcggaagtact
aagttccgcatccccgccatcatcacgctgaagcaccagacgggagccaacgcaagcaag
aacggccgtctgctggccgccatcgacgcccgctggaaccacgtcggcgacgcctgcggc
ctggacaccatcgtcagctattccgacgacaacggcggcaactggaactataacttcccc
aactacttcggcgacagcaccaatgcctacgcgacttacggcaccgcgttcatcgacccg
gtgctggtggagggtaatgacggcgccatctacatgatggtggacctctggcccggcggc
gtggccctgaacaccgcccccatgcggcccgccagcgccaccggctatgtggagatcaac
ggcacgaagcgcctggcgctctacacctcgcctgtgaccggctctcagagcgacaccaac
tactcctattacgtcggcggcttcgaggacggctacgccccggtttatgagccgacagag
ggtaaggccgataccttcgccggctactacgttgacgagtactactatctctaccacacg
gaaggcgaatttgccgaaaagactcccgccaacgacaagatctactgccagcggctgggt
aacagtgagtgggtccagcagaatgtgttcttctacaacgccagcctccacgtccgcaac
gcctcttacctctggatcgtcaagtccaccgacggcggcgagacctggagcaagccccag
atgatcaacgaccaggtgcgcaccggcgcggatcagttctacggcgtaggccccggcgcc
ggcctgtgcatggacaacggcatgattcttctgcctgtctacatctggcccgacgagcac
gccggattcatttactccgaggataacggtgcaacctggcatcggagtcccacttacgcc
accaacacaagcagagactccagcgaaagctgtctgattcagattgatgacaccaccgtg
cgccacttctaccgcgacagctggagcaacagcatggttgtgcgctacaccgaccacacc
tggaacggcacctcatggactaccggctcggtgaccagagtggagggggccccccgctgg
ggcgcctgccagctctccgccatcaaatactccaagaaagtggacggcaaggacctgatt
ctgtattccgctccctcctccaccagcaaccgtacaaagggcgtcattcacgcgttcctg
gtcaacgacgacaagaccatgacgctgtacaacacctattcggtcaacggcgacggcgtc
tacgcctactccagcctgaccgagacggcagacggcaacatcgccctgctctacgagagc
accaacgacgcggtgattttcgaaatcatccccatcaccgatatcatcccctcgaagaac
acttcgaacggcaacggctcctcttcgccctctaccaccacgacggttgagaaaaaccct
ggcggaagcaccacgacgacggttacggacaatcagactggcgccgtcaccgtgaccacc
gaaaacccggacggcagcaagaacgtggtcgagaccaagaaggacggaaccgtaaccgag
accaagatcgacgcccagggcggcaaggcggaaaaggtcagcgtcccagacgagggcatc
accgtcactgaccccagcggagaaatactggtaaagctggagctgccttctacgatccct
gaactggagcaaaaatttgcagatgttccggaaaatcactgggcagagcagggcatcctc
gacatggccgctttgggtgtgattcatggtgtgagcaacgaccgttatgacatgaacggc
cccattaagcgcgcggatatggcaacgatgctgttctgtctctccaatgtagacacgcgc
ggaaacgctcagttctccgacgtgcccgatgacgcatattacgccgaaagcgtggcatgg
gccagcgaagccggcgtggtgcgcggcgtcggaaatggccaattccttcctgaaaacgca
agcactcgcgaggagctggctgtgatgttgtatcgctacgcgatgttgctcaagctggat
accacagtctccactgacctgttgaacgcatttagcgacggcagtcagacccatagctgg
gcagaggacagcttggcttggtgtgtgaaaaaccacattatccagggcaaagacggcgaa
attctggaccccagaaacaacgcgacccgcgcggaggcggcggtgatgcttcagcggttc
ctgaaattgattgcgtaa

DBGET integrated database retrieval system