KEGG   Lingula anatina: 106156691Help
Entry
106156691         CDS       T04921                                 

Definition
(RefSeq) inactive glutathione S-transferase D3-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
lak  Lingula anatina
Pathway
lak00480  Glutathione metabolism
lak00980  Metabolism of xenobiotics by cytochrome P450
lak00982  Drug metabolism - cytochrome P450
lak00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:lak00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    106156691
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    106156691
   00982 Drug metabolism - cytochrome P450
    106156691
   00983 Drug metabolism - other enzymes
    106156691
Enzymes [BR:lak01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     106156691
Transporters [BR:lak02000]
 Other Transporters
  Pores ion channels [TC:1]
   106156691
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_3 GST_C_2 GST_C_6
Motif
Other DBs
NCBI-GeneID: 106156691
NCBI-ProteinID: XP_013387518
UniProt: A0A1S3HN75
LinkDB All DBs
Position
Unknown
AA seq 213 aa AA seqDB search
MPVDLYLFQLSPPSLAVRMACKAAEVDVNIKWINTFKKEQMTEEYLKINPDHTCPTIVDD
GFCLWESKAIMPYLLEKYGKNESLYPKDIKQRAIIDRALMFNAITFTPKVYGVLLPRLAK
NEVSEEAEKEFKEKAMDKLNRDLEGKQFIAGDNLTIADFAFWGLITLLGLFDIDTSPWSN
ICSWAERMKALPYYEECHKELFEFWEEMKKVES
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgccggttgatttgtacttgtttcagttaagtccccctagcctggctgtccgtatggcc
tgcaaggcagcggaagtggacgtgaatattaaatggataaacacatttaagaaagagcaa
atgactgaggagtaccttaagataaatccagaccatacgtgtccgactatagttgacgat
ggcttttgtctgtgggaaagcaaagctatcatgccatatctgcttgagaagtacggaaag
aacgagtcgctctacccaaaggacatcaagcagagggcaataatcgacagggccttgatg
ttcaatgccatcacatttacacctaaggtttacggagtgttgctaccaagactggctaaa
aacgaggtttctgaggaggcagagaaggagtttaaagaaaaagcaatggacaaactcaat
cgggacctggagggaaaacagttcatcgcgggagacaacctcacgatcgccgactttgct
ttctgggggctgatcactctattagggctctttgatattgatacaagtccttggagtaac
atatgctcttgggcagagcgcatgaaggcgttaccttattatgaagagtgccataaagag
ctctttgaattctgggaagaaatgaaaaaggtggaatcttaa

DBGET integrated database retrieval system