KEGG   Loxodonta africana (African savanna elephant): 100655356Help
Entry
100655356         CDS       T04351                                 

Gene name
SETD2
Definition
(RefSeq) SET domain containing 2
  KO
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:lav00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100655356 (SETD2)
Enzymes [BR:lav01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100655356 (SETD2)
Chromosome [BR:lav03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100655356 (SETD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 2522 aa AA seqDB search
MFKGVASSRFLPKGTKTKVNLEEQGRQKVSFSFSLTKKTLQNRFLTALGNEKQNDTPNSP
AIPLQADSTPKIKVDIGDTLSTTEESSPPKSRVELGKIHFKKHLLHVTSRPLLATTTAVT
SPPPPTVPLPAVIAESTTVDSPPPSPPPPPPPPQAKAPSTPAPVTEPVALPRTPIPVLMT
APMPSPVDVAVRALKEPLVTVVSESLEVDTKQDAVSNSSEERITHTSNEQADIPSQKGDS
HIGKEEEIPDSSKSSLGSRKTGSKKKSLQSEGTFFGSESDEDSVRTSSSQRSHDLKFSAS
TEKERDSKKSLASLKGEDLGKSSRSKTERDDKYFSYSKLERDTRYISSRCRSERERRRSR
SRSRSDRGSRSSLSYSRSERSHYYDSDRRYHRNSPYRERTRYSRPYTENRARESSDSEDE
YKKTYSRRTSSHSSSYRDLRTSSSYSKSDRDCKTESSYIETEKRGRYSSKLERESRRTSE
NEVVKRCSPSNDLGFRRGSSYSKHDNSASRYKAAPSKPIPKSDKFKNSFCCTELHEGIKQ
SHSFSLQTPCSKGSELRMINKIPEREKTRSPSPSNQLNDSPTFKKLDESLIFKSEFIGHD
SIKELDSLSKGKHDQLRTYCPVELNINGSPGAESDLATFCTSKTETVLMSSDDSVTGSEV
SPLIKACMRSSNGFQNISRCKEKDLDATCMQHSKSESPFRETEPPVSPHQDKLMTLPVKV
IDYSKTVVKEPVDMRVSRCKTKDSDIYYTSNDSNLSLCHSEAENTDPSVTKISSNSFMNV
HLESKTVICDNRNLTDQNSKFACEEYKQSVGSTSSASVNHFDDLCQPVGSSSIASPLQSF
PPGIKMDSLTLLRCGENTSPALDAVLMSKTSTEFLKHAGEETIVEVGSRLPDSRRGFSSW
ENRHNNGLSGKCLQETQEEGNSLLPDRRGRPEISLDEGGRGHAHTSDDSEVVFSSCDLNL
TMEDSDGVTYTLKCDSSGHASEIVSTIHGDYSGSSESSSDESDSEDTDSDDSSIPRNRLQ
SIVVVPKNSTLPMEETSPCSSRSSQSYRHYSDHWEDERLESRRHLYEEKFEVIANKTCPQ
TEKFFLHKGAEKNSDISFAQSSRKQVDNHLSEMAHPQSDGVDSTSHTDVKSDPLGHPNSE
EIVKVKIASRQQEELPVYSSDDFEDVPNKSRQQTTYPHRPDSRLGKTELSFSSSCEISLV
DGFHSSEELRNLGWDFSQPEKPTTTYQQPDSSYGACGGHKYQQSAEQYGGTHSYWQGNGY
WDPRSAGRPPGTGVVYDRIQGQVPDSLTDDREEEENWDQRGGSHFSSQSNKFLQSIQQKD
RGSVQAPEISSNSIKDSLAVNEKKDLTKNLEKNDMKDRGPLKKRRPELESDSESDGELQD
RKKVRMEVELGETAVPSGSALVGPSCVMDDFRDPQRWKECAKQGKMPCYFDLIEENVYLT
ERKKNKSHRDIKRMQCECTPLSKDERAQGEIACGEDCLNRLLMIECSSRCPNGDYCSNRR
FQRKQHADVEVILTEKKGWGLRAARDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIH
YYFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELT
FDYQFQRYGKEAQKCFCGSANCRGYLGGENRVSIRAAGGKMKKERSRKKDSVDGELEALM
ENGEGLSDKNQVLSLSRLMVRIETLEQKLTCLKLIQNTHSQSCLKSFLERHGLSLLWIWM
AELGDGRESNQKLQEEIIKTLEHLPIPTKNMLEESKVLPVIQRWSQTKTAVPQLSEGDGY
SSENTSRAHTPLNTPDPSTKLSMEADIETPKKLMFRRLKIISENSMDSAISDATSELEGK
DGKEDLDQLENIPVEEEEELQPQQLLIQQLSESRVDGEAAVEVSKLPMSEPEADTEIEPK
EGNGTKLEEPIAEETPSQDEEEGVSDVESERSQEQPDKTVDISDLATKLLDSWKDLKEVY
RIPKKSQTEKENTIIERGKDAVGFRDQTAAPKTPNRSRERDPDKQIQNKEKRKRRGSLSP
PSSAYERGTKRPDDRYDTPTSKKKVRIKDRNKLSTEERRKLFEQEVAQREAQKQQQQMQN
LGMTSPLPYDSLAYNAAHHPFAGYPPGYPMQAYVDPSNPNAGKVLLPTPSMDPVCSPAPY
DHAQPLVGHSAEPLAAPPPVPVVPHVTTPVEVSSSQYVAQSDGVVHQDSSVAVLPVPAPG
PVQGQNYGVWDSNQQSVSSVQQQYSPAQSQAAMYYPGQTCPAVYGVAAPYSQSTPPIVQS
YAQSSLQYIQGQQIFTAHPQGVVVQPAAAVTTIVAPGQQQPLQPPEVVVTNNLLDLPPPS
PPKPKTIVLPPNWKTARDPEGKIYYYHVITRQTQWDPPTWESPGDDASLDHEAEMDLGTP
TYDENPMKTSKKPKTAEADTSSELAKKSKEVFRKEMSQFIVQCLNPYRKPDCKVGRITTT
EDFKHLARKLTHGVMNKELKYCKNPEDLECNENVKHKTKEYIKKYMQKFGALYKPKEDTE
LE
NT seq 7569 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaaggtgttgcttctagtcgatttttgcccaaaggcaccaagacaaaagttaat
ttggaggaacagggacgacagaaggtgtcattcagcttcagccttacaaagaagactttg
cagaacagatttctgactgcacttggaaatgaaaagcaaaatgatactccaaactcccca
gctatacctctccaagcagattcgacccctaaaattaaagtggacattggagatacttta
tctactacagaagaatcttccccaccaaaatcaagggtggaattgggaaaaattcatttt
aaaaaacatctacttcatgtaacatctaggccgctgctggctactaccacagcagtaaca
tccccacctcctcccacagtaccattaccagcagttatagcagaatcaacaactgtagac
tcaccacccccatctccacctccaccacctccacctccccaagccaaagcaccctcaaca
ccagcaccagtaacagagccagtggccttgccacgtacaccaataccagttctgatgaca
gcaccaatgccctcaccagtagatgtagcagttagagccctgaaagaaccactggttaca
gttgtgtcagagtctttagaagtggacactaagcaggacgctgtatctaatagctcggaa
gaacgcataactcacacttcgaatgagcaagcagatattccctcacaaaaaggagattcc
catattgggaaggaagaagaaattccagatagttctaaaagtagtctgggctctagaaaa
acaggttctaagaagaaatctttacaatctgaaggcaccttttttggttcagaatctgat
gaagattctgtacggacttcctcaagtcagagatcacatgatttaaaattttcagcaagc
actgaaaaggaaagagattcaaaaaagagcttagcatctctgaaaggtgaggatttaggg
aaatcttcacgatctaaaacagagagagatgataaatattttagctactcaaaacttgaa
agagatactcggtatatatcttcccgatgtagatcagagagagagcgaaggcggagcaga
tctcgttctagatctgatagaggctctagaagtagtttatcctattctcgatcagaacga
tcccattattacgactctgatcgtcgctaccataggaactccccttatcgagagaggaca
cgctattctcgaccatatacagagaacagggcacgagagagttctgactcagaagatgag
tataagaagacgtactcaaggcgcacctcatctcattcctcctcttacagagacctaagg
acatcatcatcctattctaaatctgatcgggactgtaaaaccgagtcctcttacatagaa
acagagaaaagaggaaggtattcttcaaaactagaaagagaatccagaaggacttcagaa
aatgaagtagtgaaaaggtgttctccgtctaatgatctgggattccgacgggggtcatca
tattctaagcatgataacagtgcttctcgttataaagctgccccttcaaaacctataccc
aagtctgataaatttaaaaattctttctgttgtacagaattacatgaaggaatcaaacag
tctcattcttttagtttacagactccttgttcaaaaggtagtgaattaagaatgattaat
aaaattcctgaaagagaaaagaccaggtctccatcaccatcaaatcaattaaatgattca
ccaacttttaaaaagctagatgaatcgcttatttttaagtctgaatttataggccatgat
agtattaaggaattagactctttgtctaaagggaagcatgatcaattaagaacttactgt
cctgtagaactaaatataaatggatctcctggagcagaatctgatttggcaacattttgc
acttctaaaactgagactgttttaatgtcttctgatgatagcgtgactggatcagaggta
tcccctttgatcaaagcatgcatgcgttcgtcaaatggatttcagaatattagtagatgt
aaagaaaaagacttggatgctacttgcatgcagcatagtaagtcagagagcccgtttaga
gaaacagaacctccagtgtcaccacaccaggataaactcatgacattgccagttaaggtg
atagattattccaaaacagtagttaaagaaccagttgatatgagagtttctcgctgcaaa
accaaagattcagatatatactatacttcaaatgacagcaacctttctttgtgtcattcc
gaagctgagaatactgacccttcagttacaaagatttcttccaatagctttatgaatgtt
catttggaatcaaaaacagttatatgtgataatagaaatctgacagatcagaactcaaag
tttgcatgtgaagaatataagcagagtgttggtagcactagttcagcttctgttaatcat
tttgatgatttatgccaacctgtagggagttcaagtattgcttcacctcttcagagcttt
ccaccaggaataaaaatggacagtttaactctcttgcggtgtggagagaacacatctcca
gctttggatgctgtgctgatgagtaaaacaagcacagagtttttaaaacatgcaggggaa
gaaacaatagtagaagtgggtagccgccttcctgattcaagaaggggattttcttcctgg
gaaaacaggcataataatgggttatctgggaaatgcttgcaagagactcaagaagaagga
aattccttattacctgatagaagaggaagaccagaaatctctttagatgaaggaggacga
ggacatgcgcatacttctgatgattcagaagttgtattttcttcttgtgatttgaattta
accatggaagacagtgatggtgtaacttataccttaaaatgtgacagtagtggccatgcc
tcagaaattgtttctactatccatggagattattctggttcttctgaaagttcaagtgat
gaaagtgattcagaagatacagattctgatgatagcagtattccaagaaaccgtctccag
tccattgtggttgtgccaaagaattctactttgcctatggaagaaacaagcccttgttct
tctcggagcagtcagagttacagacactattccgaccactgggaagatgagaggttggag
tcaaggagacatttgtatgaggaaaaatttgaagttatagcaaataaaacctgtcctcag
actgagaagttttttcttcataaaggagcagagaagaactcagacatttcttttgcacag
tccagcagaaaacaagtggataaccacctgtctgaaatggctcatcctcagagtgacggg
gttgatagcacaagtcatacagacgtgaaatctgaccctctaggccatccaaattcggag
gaaatagtaaaagtcaaaatagcttctaggcaacaagaagaactgccagtttattcttct
gatgattttgaagatgtcccaaataagtctcggcaacagactacttaccctcacaggcca
gatagtagactggggaaaacagagttgagtttttcttcctcttgtgagatctctctagtt
gatggcttccactcatcagaagagctcagaaacttagggtgggacttctctcaaccagaa
aagcctactaccacgtatcagcaacctgacagcagctatggagcttgtggtggacacaag
taccagcaaagtgcagaacagtacggtgggacgcatagttactggcaaggcaatggctac
tgggatccaagatcagcaggcagacctcctggaactggagttgtgtatgaccgaattcaa
gggcaggtaccagattccctaacagatgacagggaagaggaagagaattgggatcagcgt
ggtggatcccacttttcaagccagtcaaataaattcctgcagtccattcagcagaaggac
agggggtcagtgcaagcacctgagataagcagcaattccattaaggactctttagctgtg
aatgaaaagaaagatcttacaaaaaacttagagaaaaatgacatgaaagatagagggcct
cttaaaaaaaggaggccggaattggagagtgattctgaaagcgatggtgagcttcaggat
agaaagaaagttagaatggaggtagagctgggagagacagcagtgccttcaggctctgca
ctagtgggaccttcctgtgtcatggatgacttcagggaccctcagcgatggaaggagtgt
gccaagcaggggaagatgccttgttacttcgatcttattgaagaaaatgtttatttaaca
gaaagaaagaagaataaatcccatcgggacattaagcgaatgcagtgtgagtgtacacct
ctttctaaagatgaaagggctcaaggtgaaatagcatgcggcgaagattgtcttaatcgt
ctccttatgattgagtgttcttctcggtgtccaaatggggattattgttccaatagacgg
tttcagagaaaacagcatgcagatgtggaagtcatactcacagaaaagaaaggctggggc
ttgagagcagccagagatctaccttcgaacacctttgtgctggaatattgtggagaggta
cttgatcataaagagtttaaagcccgggtgaaggagtacgcacgaaataaaaacatccac
tactatttcatggccctgaagaatgatgagataatagatgccactcagaaaggaaattgc
tctcgttttatgaatcatagctgtgaaccaaactgtgaaacccaaaaatggactgtgaat
ggacaactgagagttgggttttttaccaccaaactggttccttcaggatcagagttaaca
tttgactatcagttccaaagatacggaaaagaggctcagaaatgtttctgcgggtcagct
aattgccggggttacctgggaggagagaacagagtcagcattcgagcagcaggagggaag
atgaagaaggagcgatcccgtaagaaggattcagtggatggagaactggaagctctgatg
gaaaatggtgaaggtctctcggataaaaaccaggtgctcagcttatcccgcctgatggtt
agaattgaaactttggagcagaaacttacctgtcttaagctcatacagaacacacactca
cagtcctgcctgaaatcctttctggaacgtcatggactgtctttgctgtggatctggatg
gcagagctaggtgatggccgggaaagtaaccagaagcttcaggaagagattataaagact
ttggaacacttgcccattcctactaaaaatatgttggaagaaagcaaagtacttccagtc
attcaacgttggtctcagaccaagactgctgtccctcagttgagtgaaggagatgggtat
tctagtgagaacacatcacgtgctcacacaccactcaacacacctgatccttctaccaag
ttgagcatggaagctgatatagaaacccccaagaagctcatgtttcgtagacttaaaatt
ataagtgaaaatagcatggacagtgcaatttctgatgctaccagtgaactagaaggcaag
gatggcaaagaggaccttgaccagttagaaaacatccctgtagaggaagaggaagagttg
cagccacaacagctactcatacaacagctgtctgaatccagagttgatggtgaagctgca
gtggaggtcagtaagctccccatgtctgaaccagaggccgacactgaaatagagcccaaa
gagggcaatggcacaaaactggaagaacctattgctgaggaaacaccatcccaagatgaa
gaggagggtgtttctgatgtggagagcgaaaggagccaggaacagccagataaaacagtg
gatataagtgatttggccaccaagctcctggatagttggaaagacctaaaggaggtatat
cgaattccaaagaaaagtcaaactgaaaaggagaacacaataattgaacgaggaaaggat
gctgttggcttcagagatcaaacggctgccccaaagactcctaacaggtcaagagagaga
gacccagacaagcaaattcaaaataaagagaaaaggaaaagaaggggctccctctcacca
ccctcttctgcttatgagcggggaacaaaaaggccagatgacagatatgatacaccaact
tctaaaaagaaagtacgaattaaagaccgcaataaactttctacagaggagcgtcggaag
ttgtttgagcaagaggtggctcagcgggaggctcaaaaacaacagcagcagatgcagaac
ctaggaatgacatctcccctgccctatgactctcttgcatacaatgccgctcatcacccc
tttgctggctacccaccaggttatcccatgcaagcctatgtggatcccagcaaccctaat
gctggaaaggtgcttctgcccacacccagcatggaccctgtatgttctcctgctccttac
gatcatgctcagccattggtgggacactctgcagaaccccttgctgcccctccaccagtg
ccagtggtgccacatgtgacaacccctgtggaagtttccagttcacagtatgtggcccag
agcgatggtgtggtacaccaagactccagtgttgccgtcttgccagtgccggccccgggc
ccagtccagggacagaattacggcgtttgggattccaaccagcagtctgtcagcagcgtg
cagcagcagtactcccccgcgcagtctcaagcagccatgtattacccaggtcagacgtgt
ccggccgtctacggtgtggccgcaccgtactcacagagcactccaccaatcgtacagagt
tatgcgcagtcaagtcttcagtacatccagggacagcagattttcacagctcacccacaa
ggagtggtggtacagccagccgcagccgtgactacaattgttgcaccagggcagcagcag
cccttacagccacctgaagtggttgtgacaaataatctcctggatctgccacctccttct
cctcccaaaccaaaaactattgtcttacctcccaactggaagacagcccgagatcccgaa
gggaagatttattactaccatgttatcacaaggcagactcagtgggatcctcctacttgg
gaaagccctggagatgatgccagccttgaccatgaagctgagatggacctaggaacccca
acttatgatgaaaatcccatgaagacctcgaaaaagcccaagacagcagaagcagacacc
tccagtgagctggccaaaaaaagcaaagaagtattcagaaaagagatgtcccagttcatt
gtccagtgcctgaacccttaccggaaacctgactgcaaagtgggaagaattaccacaact
gaagacttcaaacacctggctcgcaagctgacacatggcgttatgaataaggagctgaag
tactgtaagaaccctgaggacctggagtgcaatgagaatgtgaaacacaaaaccaaggag
tacatcaagaagtacatgcagaaatttggggctctttacaaacccaaagaggacactgaa
ttggagtga

DBGET integrated database retrieval system