KEGG   Loxodonta africana (African savanna elephant): 100655538Help
Entry
100655538         CDS       T04351                                 

Gene name
GSTZ1
Definition
(RefSeq) glutathione S-transferase zeta 1
  KO
K01800  
maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:lav00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    100655538 (GSTZ1)
Enzymes [BR:lav01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     100655538 (GSTZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 265 aa AA seqDB search
MQAGKGIQMLTLASLPHSPVCSSPSRVPPPALQFCERFPGSLKVTGGTMAESSKPILYSY
FQSSCSWRVRIALALKGIDYETVPVNLVKDGGQQFSEEFQALNPMKQVPALKIDGLTISQ
SLAIIEYLEETRPTPRLLPQNPKQRATVRMISDLVASGIQPLQNLSVLKQVGQESGLAWA
QKVINTGFNALEKILQSTAGKYCVGDEVSMADLCLVPQVANAERYKVEVTLYPTISRINK
TLLALEAFQVTHPCRQPDTPPEMRA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctgggaagggcatccagatgttgaccctcgcctctcttccgcacagccctgtg
tgctcctctcccagccgagttcctccccctgccctgcagttctgtgagagatttcctggg
agcttgaaagtcactggtggcacaatggctgagtccagcaagcctatcctgtactcctat
ttccaaagctcctgctcatggagagttcgaattgctctagccttgaaaggcattgactat
gagacggtgcctgtcaatcttgtgaaggatggggggcagcagttctctgaagaattccag
gcactgaatcccatgaagcaagtgccagccctgaagattgatggactcaccattagccag
tcactggccatcattgagtacctggaggagactcggcccactccgcgactcctgcctcag
aacccaaagcagagggccaccgtgcgcatgatttcggacctcgttgctagcggcatccag
cccctgcagaatctgtctgtcctgaagcaagtgggtcaggagagcgggctggcctgggcc
cagaaggtcatcaatactggctttaatgctctggagaagatcctgcagagcacagcgggg
aagtactgtgtgggagatgaggtttccatggctgatctgtgtctggtgcctcaggtggca
aatgctgaaaggtacaaggtggaggtcactctttaccctaccatcagccgcatcaacaag
actctgctggccttggaggccttccaagtgactcatccctgccggcagccagatacgccc
cctgagatgagggcctag

DBGET integrated database retrieval system