KEGG   Loxodonta africana (African savanna elephant): 100666359Help
Entry
100666359         CDS       T04351                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00590  Arachidonic acid metabolism
lav01100  Metabolic pathways
lav04064  NF-kappa B signaling pathway
lav04370  VEGF signaling pathway
lav04625  C-type lectin receptor signaling pathway
lav04657  IL-17 signaling pathway
lav04668  TNF signaling pathway
lav04723  Retrograde endocannabinoid signaling
lav04726  Serotonergic synapse
lav04913  Ovarian steroidogenesis
lav04921  Oxytocin signaling pathway
lav04923  Regulation of lipolysis in adipocytes
lav05140  Leishmaniasis
lav05165  Human papillomavirus infection
lav05167  Kaposi's sarcoma-associated herpesvirus infection
lav05200  Pathways in cancer
lav05204  Chemical carcinogenesis
lav05206  MicroRNAs in cancer
lav05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:lav00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100666359 (PTGS2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    100666359 (PTGS2)
   04064 NF-kappa B signaling pathway
    100666359 (PTGS2)
   04668 TNF signaling pathway
    100666359 (PTGS2)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    100666359 (PTGS2)
   04657 IL-17 signaling pathway
    100666359 (PTGS2)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    100666359 (PTGS2)
   04913 Ovarian Steroidogenesis
    100666359 (PTGS2)
   04921 Oxytocin signaling pathway
    100666359 (PTGS2)
  Nervous system
   04726 Serotonergic synapse
    100666359 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    100666359 (PTGS2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100666359 (PTGS2)
   05206 MicroRNAs in cancer
    100666359 (PTGS2)
   05204 Chemical carcinogenesis
    100666359 (PTGS2)
   05222 Small cell lung cancer
    100666359 (PTGS2)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100666359 (PTGS2)
   05165 Human papillomavirus infection
    100666359 (PTGS2)
   05140 Leishmaniasis
    100666359 (PTGS2)
Enzymes [BR:lav01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     100666359 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 100666359
NCBI-ProteinID: XP_003410884
UniProt: G3SWN5
LinkDB All DBs
Position
Unknown
AA seq 604 aa AA seqDB search
MLARVLLLCAALALGHAANPCCSSPCQNRGVCMTTGFGQYTCDCTRTGFYGENCSTPEFL
TRIKMLLKPTPNTVHYILTHFKGVWNIVNNIPFLRNAIMKYVLTSRAHLIDSPPTYNVHY
GYKSWEAFSNLSYYTRALPPVPHDCPTPMGVKGKKELPDSKEIVEKFLLRRKFIPDPQGT
NMMFTFFAQHFTHQFFKTDHKRGPGFTKGLGHGVDLNHVYGETLDRQHKLRLFKDGKMKY
QIIDGEMYPPTVKETQAEMIYPPHVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLRQEHPEWDDEQLFQTSRLILIGETIKIVIEDYVQHLSGYNFKLKFDPELLFNQEFQYQ
NRIAAEFNTLYHWHPLLPDAFQIDNQEYSYQQFIYNNSILLEHGLTQFVESFTRQIAGRV
AGGRNVAPAVQKVAQASIDQSREMKYQSVNEYRKRFRMRPFTSFEDLTGEKEMAAELEEL
YGDIDAMELYPALLVEKPRPDAIFGETMVELGAPFSLKGLMGNTICSPNYWKPSTFGGEV
GFKIINTASIQSLICNNVKGCPYTAFSVPDSQLSKPAVINASSSHSRLDDINPGVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgcgtcctgctgctgtgcgcagccctggcgctcggccacgcagcaaatcct
tgctgttccagcccgtgtcaaaatcgcggcgtatgtatgaccacagggtttggtcagtac
acatgcgactgcactcgtacaggattctacggggaaaactgttcgacacctgaatttctg
acaagaataaaaatgttactgaaacccacccccaacacagtgcactacatacttacccat
ttcaagggagtttggaacattgtcaataacatcccctttctgcgaaatgccattatgaaa
tatgtgctgacatcaagagcacatttgattgatagcccgccgacttataatgttcactac
ggctataaaagctgggaagccttttccaacctctcctattacaccagagcccttcctcct
gtacctcatgactgtcctactcccatgggggtgaaaggaaagaaggaacttcctgattcg
aaagagattgtggaaaaatttcttctgagaagaaagttcatcccagatccccagggcacc
aatatgatgtttacattctttgcccagcacttcacccatcagtttttcaagacagatcat
aagcgaggaccaggtttcaccaaaggattgggccatggggtggatttaaatcatgtttat
ggtgaaactctggatagacagcataaactgcgccttttcaaggatggaaaaatgaaatat
cagataattgatggagagatgtatcctcccactgtcaaagagactcaggcagagatgatc
tacccgcctcatgtccctgaacacctgcggtttgctgtgggccaggaggtctttgggctg
gtgcctggcctgatgatgtatgccacaatctggcttcgggaacataacagggtgtgcgac
gtgcttagacaggagcatccagaatgggacgacgagcagttgttccagacaagcaggctc
atactgataggagagactattaagattgtgattgaagactatgtgcagcacttgagcggc
tataacttcaaactgaagtttgaccccgagctgcttttcaaccaagaattccagtaccaa
aaccgtattgctgctgaatttaacacactctaccactggcaccctcttctacctgacgcc
tttcaaattgataaccaggagtacagctatcaacagtttatctacaacaactctatatta
ctggagcatggacttacccagtttgttgaatcattcaccaggcaaattgctggcagggtt
gccggtggcaggaatgttgcacctgcagtacaaaaagtagcacaggcatctattgatcag
agcagagagatgaagtaccagtctgtcaatgagtaccgcaaacgcttccggatgagaccc
tttacgtcatttgaagaccttaccggagagaaagaaatggctgcagagttagaggagctc
tatggtgacattgatgctatggaactctatcctgcccttctggtagaaaagcctcgtcca
gatgccatcttcggtgagaccatggtagaactgggagcaccattctccttgaaaggactc
atgggtaatactatatgttctcctaactactggaagcctagcacttttggtggagaagta
ggctttaaaatcatcaacacagcctcaatccagtctctcatctgcaataacgtgaagggc
tgtccctacaccgcattcagtgttccagattcacagctcagcaaaccagccgtcattaat
gcaagctcatcccactccaggctggatgatatcaaccctggagtactgctaaaagaacgt
tcaactgaactataa

DBGET integrated database retrieval system