KEGG   Loxodonta africana (African savanna elephant): 100667678Help
Entry
100667678         CDS       T04351                                 

Gene name
GAD2
Definition
(RefSeq) LOW QUALITY PROTEIN: glutamate decarboxylase 2
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lav  Loxodonta africana (African savanna elephant)
Pathway
lav00250  Alanine, aspartate and glutamate metabolism
lav00410  beta-Alanine metabolism
lav00430  Taurine and hypotaurine metabolism
lav00650  Butanoate metabolism
lav01100  Metabolic pathways
lav04727  GABAergic synapse
lav04940  Type I diabetes mellitus
Module
lav_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:lav00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    100667678 (GAD2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100667678 (GAD2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100667678 (GAD2)
   00430 Taurine and hypotaurine metabolism
    100667678 (GAD2)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    100667678 (GAD2)
 Human Diseases
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    100667678 (GAD2)
Enzymes [BR:lav01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     100667678 (GAD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 100667678
NCBI-ProteinID: XP_010588972
LinkDB All DBs
Position
Unknown
AA seq 588 aa AA seqDB search
MASPGSGFWSFGSEDGSGDPENPGTARAWCQVAQKFTGGIGNKLCALLYGDAEKPAESDG
REPXRAIPRKGVWARDQEAPAVAPRGEVNYAFMHATDKDLLPACNGERPTLAFLQDVMDI
LLQYVVKSFDRSTKVIDFHYPNELLQEYNWELADQPQNLEEILTNCRTTLKYAIKTGHPR
YFNQLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWSGGSGDG
IFSPGGAISNMYAMLIARFKAFPEVKEKGMAAVPRLIAFTSEHSHFSLKKGAAALGIGTD
SVILIKCDERGKMIPSDLERRILEAKQKGFVPFLVSATAGTTVYGAFDPLLAIADICKKY
NIWMHVDAAWGGGLLVSRKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQR
CNQMHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGFEAQIDKCLEL
AEYLYNIIKNREGYEMVFDGKPQHTNVCFWYVPPSLRTLEDNEERMSRLSKVAPVIKARM
MEYGTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggcatctcctggctccggcttttggtccttcgggtccgaagatggctctggggatccc
gagaaccctggcacagcgagagcctggtgccaggtggcccagaagttcaccggcggcatc
ggaaacaagctgtgcgccctgctctacggagacgcagagaagcccgcggagagcgatggc
agggaaccctagcgggccatccctcggaaaggcgtctgggcccgtgaccaagaagccccg
gcagttgccccaaggggggaagtcaactatgcgtttatgcacgcaacagataaagacttg
ctgccagcttgcaatggagaaaggcccactttggcgtttctgcaagatgttatggacatt
ttgcttcagtatgtggtgaaaagtttcgatagatcaaccaaagtcattgatttccattac
cctaatgagcttcttcaagagtataattgggaattagcagaccagccacaaaatttggag
gaaattttgacgaattgccgaacaactctaaaatatgcaattaaaacagggcatcccaga
tatttcaatcaactttccactggattggatatggttggattagcagccgattggctgaca
tcaacagcaaatactaatatgtttacctatgaaattgctccagtatttgtgcttttggaa
tatgtcacactaaagaaaatgagagagatcatcggctggtcagggggctccggcgacggg
atattttctcctggtggagccatatctaacatgtacgccatgctgattgcgcgcttcaag
gcattcccagaagtcaaggagaaaggaatggccgccgttcccaggctcattgccttcaca
tccgaacatagtcatttttcgcttaagaagggagctgcagccttggggattggaacagac
agcgtgattctgattaaatgtgatgagagagggaaaatgatcccatctgatcttgaaaga
aggatccttgaagccaaacaaaaaggatttgttcctttccttgtgagcgccactgctgga
accaccgtgtatggagcgttcgatcccctcttagctattgctgacatttgcaaaaaatat
aacatctggatgcatgtggatgcagcttggggaggaggattactggtatcccggaaacac
aaatggaaattgagcggcgtggagagggccaactctgtgacatggaatccacacaagatg
atgggtgtccctttgcagtgttcagctctcctggttagagaagagggattgatgcagagg
tgcaaccagatgcatgcctcctacctctttcagcaagataaacactacgacctgtcctat
gacactggagacaaagccctacagtgcgggcgccatgtcgatgtttttaagttgtggcta
atgtggagggcaaagggaactactgggtttgaagcacagattgacaagtgtttggagctg
gcggagtatttatacaatatcataaaaaaccgagaaggatatgaaatggtgtttgatgga
aagcctcagcacaccaatgtctgcttctggtatgtacctccgagcttgcgtactctggaa
gacaatgaagaaagaatgagtcgcctctcaaaggtggctccagtgattaaagccagaatg
atggaatacgggaccacaatggtcagctaccagcccttgggagacaaggtcaacttcttc
cgcatggtcatctcaaaccccgcagcaactcatcaagacattgacttcctgattgaagaa
atagaacgccttggacaagatttataa

DBGET integrated database retrieval system