KEGG   Laccaria bicolor: LACBIDRAFT_184098Help
Entry
LACBIDRAFT_184098 CDS       T01044                                 

Definition
(RefSeq) hexokinase
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
lbc  Laccaria bicolor
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LACBIDRAFT_184098
   00051 Fructose and mannose metabolism
    LACBIDRAFT_184098
   00052 Galactose metabolism
    LACBIDRAFT_184098
   00500 Starch and sucrose metabolism
    LACBIDRAFT_184098
   00520 Amino sugar and nucleotide sugar metabolism
    LACBIDRAFT_184098
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LACBIDRAFT_184098
Enzymes [BR:lbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     LACBIDRAFT_184098
Membrane trafficking [BR:lbc04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    LACBIDRAFT_184098
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
AA seq 501 aa AA seqDB search
MVLSRRGSGSFTLPTGQTLAIHTRTHDEEDLPHATKKCVFVATRHCKPQTFTLTPQRMRI
IVESFKETLELGLQKPEQIVPMIPTFVFGWPTGQEKGDYLAVDLGGTNLRVCLVTLQGEG
KFEISQSKYRLTEEQKQEDGQKLFDFCAQCLKTFVDTSLADGSLTLKPGETLPLGFTFSY
PCHQLKIDHGILIRWTKGFAALNTEGHDVAEMFRKSLVTYQLPVTLTALINDTTGTLIAS
HYVNPNAKIAVIFGTGCNAAYMEKVSEITKINDVGIPGDASMCINCEWGAFDSFEHEHLP
RTKYDIIVDESSNKPGEQAFEKLISGRYLGEILRLVICELVDEGVLFLGQNTYKLENPYV
FDTAFLSLMESDPTDELLMIIGIFSHFFAVETTLAERQFFRALAKLIGRRAARLSACGIA
AIVGRMGYLDNGEGCEVGADGSLYNKYPGFADRVHEGLVDIFGEKGRKIVTHHAEDGSGV
GSAIIAAMTKTRKEQRLYDHV
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggtcctctcacgtcgtggcagcggcagcttcaccttgcccacagggcaaaccctggcc
atccacactaggacccacgatgaggaagatctcccccacgcaaccaagaagtgcgtcttt
gtcgctacgagacactgtaagcctcagacattcacgttgactcctcagcggatgaggata
attgtggaatcatttaaagagactttagagttgggcttgcaaaagcctgaacaaatcgtg
ccaatgatacctaccttcgtctttggttggccgacaggacaggagaaaggcgactatctt
gccgtcgatctaggtggcacgaacctgcgcgtatgccttgttaccctacagggcgaaggc
aaatttgaaatctcccagtccaagtatcggcttacggaggaacaaaagcaggaagacggt
caaaagctgttcgacttctgcgcgcagtgcttgaagacgttcgttgatactagcctggca
gatggctcacttactttgaagcctggggagaccctgcctcttggattcaccttttcctac
ccatgccatcagctgaaaatcgaccatggcattctcatccgctggacaaaagggtttgcg
gcactcaacacggaaggccatgatgtagcggaaatgttccgcaagtccctcgttacatat
caactccctgtcacacttacggcgctcatcaacgacaccaccggtacccttatcgcgtcc
cactacgtcaaccctaatgccaaaattgcggtcatctttggcacgggatgcaacgctgcg
tatatggagaaagtcagcgagattacgaagataaacgacgtgggcattccaggagacgca
tcgatgtgtatcaactgtgaatggggggcctttgattccttcgagcatgaacacctccca
aggacaaagtacgatatcattgtcgatgagtcatcgaataaacctggggaacaggcattt
gagaaactcatctctgggagataccttggcgaaatcctgcgtctcgtaatctgcgagcta
gttgatgagggggtgctcttcctagggcagaacacgtacaagctcgagaacccctacgtc
tttgacactgctttcctgtctttaatggagagtgacccaactgatgaactcctgatgatc
atcggcatcttttctcacttcttcgccgttgaaactaccctggccgaacgccaattcttc
cgcgccctagccaaactcattgggcgacgtgctgcgcgtctgagcgcctgtggtatcgcg
gccatcgttggacggatgggatacctggacaatggcgagggttgtgaggttggtgctgat
gggtctttatataataaatatcctgggttcgcagatcgggtacatgaggggcttgttgac
atatttggagagaaggggaggaagattgtgacgcatcatgcggaagatgggagtggcgtt
gggagcgccatcattgctgccatgacgaagactagaaaagagcagcgcctctacgaccac
gtctaa

DBGET integrated database retrieval system