KEGG   Lactobacillus buchneri CD034: LBUCD034_0886Help
Entry
LBUCD034_0886     CDS       T02244                                 

Gene name
ppcA
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
lbn  Lactobacillus buchneri CD034
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lbn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LBUCD034_0886 (ppcA)
  Energy metabolism
   00680 Methane metabolism
    LBUCD034_0886 (ppcA)
Enzymes [BR:lbn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     LBUCD034_0886 (ppcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(907183..908691)
Genome map
AA seq 502 aa AA seqDB search
MDRKIPNIMGTQHPDNAGVPFFKHNDNAFVSAFREIDEAYQNFSKLDADEYMWDWEGKHA
DASVIDRLYSEHYEYFQKHPLGKDKYLTFRLPNIWEEKGYSLMQAMTTILSAEDFAYDLG
FKERPLFEAILPMTQSADQLISMEDKFASLSHYKSTEFNTGHKDSDTLQMIPLFEGFESQ
LHAPQILKKYLEMYKDHFGRELSYMRVFLAGSDSALSNGFLNSIIGNKLALTGLAEFEQE
SGLPIYPIAGTGSTIFRGGLSPMMIDRYLEEFPGLKTATIQSAFRYDYPLDVVEPAIIKL
RDGLQKSKFEIIDHDDQDILLEIAKKAAAEYHETLDPLINDLQPVFDAFPKRRDRHQHVG
IIGYSRDVDGYKMPRAITFTGALYSVGVPPEFLGTGRILNKLSDKELNTLMKYYPNIKHD
YAHVAKYFSKDALDALQAKNPAWKAVDEDIEAVERLFGIQAGPQTPEQEKHAQLAADLVK
ISDKETKTTLISRQAILRKFLG
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggatagaaaaatccctaatattatgggtactcaacatccagataacgcaggagttcca
ttcttcaagcacaacgataatgcatttgtatccgcatttcgtgaaattgatgaagcttac
caaaacttttccaagctcgatgccgatgagtatatgtgggactgggaaggcaaacacgcc
gatgcatccgtcattgaccgtttgtactccgagcactacgaatatttccaaaagcatccc
cttggcaaagataagtacctcactttccgtctgccaaacatttgggaagaaaagggctac
agtttgatgcaggcaatgaccaccatcttgtccgctgaagactttgcttacgatttgggg
tttaaggaacgaccgttattcgaagctatcttgcccatgacccaatcagccgaccagctg
atttccatggaagacaagttcgccagcctttcccactacaagtcaactgaatttaatacc
gggcacaaagattcagatactctgcaaatgattccattgtttgaaggattcgaatcccag
ttacacgccccacaaatcctgaaaaaataccttgaaatgtacaaagaccactttggccgt
gaattaagctatatgcgggtcttcttggccggatccgattccgctctttcaaacggtttc
ttgaacagtatcattggtaacaaattagccttgaccggtttggccgaatttgaacaagaa
tccggcctgccaatctatccaattgccggaaccggaagcaccatcttccgtggcggccta
tcaccaatgatgattgaccgttacctcgaagaattccccggtttgaagacggcaacgatt
caatcggcattccgttacgattacccgctggatgtggttgaaccagcgatcatcaaactg
cgcgacggccttcaaaagagcaaatttgaaattatcgatcacgacgaccaagacattctc
ttggaaatcgctaaaaaagccgctgcagaatatcacgaaactttggatccactcattaac
gacttacagccggtatttgatgcctttccaaagcgtcgggaccgtcaccaacacgtcgga
atcatcggttactcacgtgacgtcgatggctataagatgcctcgggcgatcacctttacc
ggtgccctgtactcagttggggttccgccagaatttcttggaactggccgcatcttgaac
aagctaagcgacaaagaattgaacaccttaatgaaatactatccaaatatcaaacacgat
tatgcccacgttgccaaatacttcagcaaggacgccttggatgctcttcaagccaagaac
cctgcctggaaagcggttgacgaagatattgaagcagttgaacgactattcggtattcag
gccggcccacagacacctgaacaagagaagcatgcccaactagccgctgatctggttaag
atttctgataaagaaaccaagaccaccttaatcagtcgtcaggcaatcttgcgtaagttc
ttaggctaa

DBGET integrated database retrieval system