KEGG   Leptolyngbya boryana: LBWT_6640Help
Entry
LBWT_6640         CDS       T04848                                 

Definition
(GenBank) hypothetical protein
  KO
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lbo  Leptolyngbya boryana
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lbo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBWT_6640
   00020 Citrate cycle (TCA cycle)
    LBWT_6640
   00620 Pyruvate metabolism
    LBWT_6640
Enzymes [BR:lbo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LBWT_6640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
711402..712691
Genome map
AA seq 429 aa AA seqDB search
MIHEIFMPALSSTMTEGKIVSWLKAPGDKVEKGETVVVVESDKADMDVESFYEGFLATIV
VDAGNSAPVGSAIALLAETEAEIEAAKQQATQTTPSAPAATAAATTPTPEPVAAAATNGS
SSAPTQNGRIVASPRARKLAKELKVELGAVVGSGPHGRIVAEDIEKAAGKTPTVKPAAKP
AAPVAPAVAAAPAPRAASAPVAPTQPGQIKPMTTLQTAVVRNMNASLDVPVFRASYTITT
DALDKLYKQVKSKGVTMSALLTKAIAMALQKHPLLYASYVENGIHFNESINIANAVAMED
GGLITPVLKNADQQDLYSLSRNWKDLVDRARSKQLQPDEYSSGTFTVSNLGMFGVDAFDA
ILPPGQGAILAIGASRPTVVATDDGLLGVRRQMQVNITCDHRIIYGADAAIFLRDLAKLI
ETDVQSLTL
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgatccacgaaatttttatgcccgccctcagttccaccatgaccgaaggaaaaatcgtg
tcctggctcaaagctccgggcgacaaagttgagaaaggtgaaaccgttgtggtggttgag
tctgacaaggctgacatggacgtagaatccttttatgaaggatttttagctacgatcgtc
gttgatgcaggcaactcagctccggtcggatctgcgatcgcgctcttagctgaaaccgaa
gccgagatcgaagccgcgaaacaacaagcaacccaaactactcccagcgctccggctgcc
accgctgctgcgacaacacccactccagaacctgtggcagcggctgccaccaatggctca
tctagtgcgccgactcaaaacggacgcatcgttgcttctccacgcgcacggaaactcgca
aaagaattaaaagttgaactgggtgctgtggttggaagtggtccgcacggtcggattgtg
gcagaagatatcgaaaaagctgctggcaaaaccccaaccgtcaaacctgccgcaaaacct
gctgcacctgttgcgcctgctgttgccgctgcacctgctccaagagcagcgtctgcacct
gttgctccaacccaacccggtcaaatcaagccgatgacgaccttgcaaaccgcagtcgtc
cggaatatgaatgcaagtttagatgttccagtcttccgcgcttcctacacgattacaacg
gatgcactcgacaaactgtacaagcaggtgaaatccaagggcgtaacgatgtcagccttg
ctgacaaaagcgatcgcgatggcgttgcaaaaacatcctttactgtatgcaagctatgtt
gagaacggtattcactttaatgaatcaatcaacattgcaaatgcagttgcaatggaagat
ggtgggttgatcactcctgtattgaaaaatgcagatcagcaagatctttactcgctgtct
cggaactggaaagatttagtcgatcgtgcaagatcaaaacaactccaacccgatgaatat
agttctggaacgttcacagtctcgaacttaggcatgtttggtgtggatgcgtttgatgca
atcttgccaccaggacagggagcgattttagcgatcggcgcatctcgtccaaccgtagtt
gcaaccgatgatggactgctcggagtacgccgacaaatgcaggtaaatatcacttgcgat
caccgcattatttacggtgctgatgcggcaatcttcttgcgtgatttagcaaaactgatt
gaaaccgatgttcaatcgttgacgctgtaa

DBGET integrated database retrieval system