KEGG   Lactobacillus brevis ATCC 367: LVIS_1291Help
Entry
LVIS_1291         CDS       T00406                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
lbr  Lactobacillus brevis ATCC 367
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LVIS_1291
Enzymes [BR:lbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     LVIS_1291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(1263102..1263686)
Genome map
AA seq 194 aa AA seqDB search
MAQLFFRYGAMNSGKTIEILKVAHNYEEQHKRVIIMTSGLDTRDEVGYIASRIGLKRQAH
PIFQDTDLFEEIQRIDAQANCVLIDEAQFLTKAHVFQLAKVVDELKIPVMTFGLKNDFRN
ELFEGSKYLLLYADKIEEMKTICWFCTKKAIMNLRFHNDQPVYEGEQVQIGGNEAYYPVC
RRHYFNPPLDQIGK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcagctattttttcggtatggtgcaatgaatagcgggaagaccattgaaatctta
aaggtcgcccataactatgaggaacaacataagcgagtgatcatcatgaccagtggacta
gatacccgtgatgaggtcggttacatcgccagtcgaattggactaaaacggcaagcacat
cctatttttcaagacacggatctctttgaagaaattcaacgcattgatgcccaagcaaac
tgcgtattaatcgatgaagcgcagttcttgaccaaagcacatgtgttccagttggctaag
gtagttgatgaactgaagattccggtcatgacgtttggcttaaagaacgattttcgcaac
gaattattcgaaggttccaaatacctgttgctatacgcagataaaatagaagaaatgaag
acgatttgctggttctgcaccaaaaaagcgattatgaatttgcgctttcacaatgaccaa
cccgtgtacgaaggcgaacaagtgcaaattggtggtaatgaagcctattaccccgtttgt
cgtcgccactatttcaacccaccattagatcagattgggaaataa

DBGET integrated database retrieval system