KEGG   Lactobacillus casei LC2W: LC2W_0127Help
Entry
LC2W_0127         CDS       T01956                                 

Gene name
ddl
Definition
(GenBank) UDP-N-acetylmuramate--L-alanine ligase
  KO
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lce  Lactobacillus casei LC2W
Pathway
D-Alanine metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lce00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    LC2W_0127 (ddl)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LC2W_0127 (ddl)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    LC2W_0127 (ddl)
Enzymes [BR:lce01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LC2W_0127 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:lce01011]
 Precursor biosynthesis
  Amino acid ligase
   LC2W_0127 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(138388..139461)
Genome map
AA seq 357 aa AA seqDB search
MKIVVLAGGRSTERNVSISSGYRITNALRQKGQQATFIDLFLGYDLEGKTVEQVFDDANT
SKDLNISDAILTDEDINKLRPDGSTQLFGPNVMAICKAADIVFLALHGGDGENGKVQAVF
DINGVKYTGSGPLASGITMNKVFSKEVMLYHGIQTSGFKEFKRDQGPKQTVPFDFPVVVK
PTSGGSSVGTHIIHNQEELESGLEDVFRFDNSAIVEEFTPGREFSLGVVNGHAYSAIEIK
VRSGWYDFKHKFQAGYTDFITPPKDLDEDVHQAMKDVAVQTMDVLGLQNYGRIDFFANEK
GVWVIEANNLPGMTPLSLLPQEAEADGVDYGDLVMDIVNGKLKLYADGMTEAGLLTK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgtcgttttagcaggcggccggagcacggagcgcaatgtttccatttctagc
ggctaccggatcacgaacgccttgcggcaaaaagggcagcaggccacctttattgacctg
tttcttggctacgacctcgaagggaagacggtcgaacaggtttttgatgacgccaacacc
agcaaggatctgaatatttcagatgcgattctgactgatgaagacatcaataagttacgg
ccagatggcagcacccagctatttggtcccaatgttatggcgatctgcaaagcagcagac
attgttttcctcgctttgcatggtggcgatggcgaaaacggtaaggttcaggctgtgttt
gacatcaacggggtcaagtatactggctctggcccgctggcttcaggcatcaccatgaac
aaggttttcagtaaggaagtcatgttgtatcatggcattcagacttcaggattcaaggaa
ttcaagcgcgatcaagggccaaaacaaacggttccgtttgactttccagttgttgtcaag
ccaacatccggtggttccagcgttgggacacatattattcataatcaggaagaactcgaa
agcggccttgaagatgttttccgcttcgacaacagtgccattgttgaagagttcacccca
ggccgcgaattctcgttaggcgttgtcaatggccacgcttactcggccatcgaaatcaag
gtgcgttctggttggtatgatttcaagcataaattccaagccggctacaccgacttcatc
accccgccaaaggatctcgatgaagatgtccatcaggctatgaaagatgttgccgtccaa
acgatggatgttctgggcctgcaaaattacggccgaatcgacttcttcgccaacgaaaaa
ggtgtttgggtcattgaagccaacaacctgccggggatgacaccactgtcactgttgccg
caagaagccgaagcagacggtgttgactacggcgatttggtgatggatattgtcaacggc
aagctcaagctctacgctgacggcatgaccgaggctggactcttaacgaagtaa

DBGET integrated database retrieval system