KEGG   Lates calcarifer (barramundi perch): 108875837Help
Entry
108875837         CDS       T04895                                 

Gene name
ace
Definition
(RefSeq) LOW QUALITY PROTEIN: angiotensin-converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
lcf  Lates calcarifer (barramundi perch)
Brite
Enzymes [BR:lcf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     108875837 (ace)
Peptidases [BR:lcf01002]
 Metallo Peptidases
  Family M2
   108875837 (ace)
Exosome [BR:lcf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108875837 (ace)
CD molecules [BR:lcf04090]
 Proteins
  108875837 (ace)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 1283 aa AA seqDB search
MGTGVDRFLWSVLLLLPVLGLCVALPATWLPGEYTNTTDDALRFLSDYNSTAEEVLFHSV
SASWNYNTNITEHNSMLQVNAALEEQAFSEAWGLKAKQVFTRELLNSLSSSDKKLMEKIM
MLGAANLLQKEREEYNTILSTMDNIYSTSKVHPEPNVSWSLEPHLTDIMANSRSYKRLLY
VWEGWHNASGVPLKQYYPRFVELSNKASQADGFADTGADWRSWYETETFEQDLEKLYRTI
EPLYQNLHAFVRRQLYNQYGPKYINLKGPIPAHLLGNMWAQTWNNIYGMMIPFPDKPNMD
VTDEMVRQGYNATHMFRVAEEFFTSLDLEPMPQEFWDESMLVKPEGREVVCHASAWDFYN
RKDFRIKQCTTVTMEQLFTVHHEMGHIQYYLQYKDQPVGYRRGANPGFHEAIGDVLSLSV
STPKHLHTINLLESVTSDAETDINYLLKMALEKIAFLPFGYLIDQWRWGVFSGSTPKERY
NSDWWYLRTKYQGICPPTRRTEEHFDAGAKYHIPGNTPYIRYFVSFILQFQFHEKLCEAA
KHTGPLHTCDIYRSKEAGAILKKVLQAGSSKPWPDVLQEAIGTNKMDASSLMKYFDPIIK
WLEKQNVNETLGWPDFDWVPPIPEGYPEDISKNTDELDAKKFLDEYNTTAEVVWNAYTEA
SWKYNTDINEANKQAMLEKNLEMSAHTLRYGQKARQYDTTDFQDPSVKRIIKKLSDIERA
ALSPAELEEYNTLLSNMETKYSVAEVCRDDGTCHPLDPDLQKIMAESRDYDELLFAWKGW
RDSAGKVLRQDYKRYVELANKAATLNGHPDNGAFWRSLYETPTFEEDLESLWKELEPLYQ
NVHAYVRRALYKKYGPEYINLKGPIPAHLLGNMWAQTWSGIMDLVMPYPDATQVDATPAM
VAKGWNATRMFQESDNFFTSLGLLPMPKEFWDKSMLEKPSDGRQVVCHASAWDFYNRKDF
RIKQCTVVTMDDLITVHHEMGHVQYFLQYKDQPVSFRDGANPGFHEAIGDVLALSVSTPK
HLQSIGLLDKVENNHESDINFLMSMALDKIAFLPFGYLMDQWRWKVFDGRIPSTEYNKEW
WNLRMKYQGLCPPVTRTEDDFDPGAKFHIPANVPYVRYFVSFVIQFQFHKALCDAANHVG
PLHTCDIYKSKEAGKLLGDVMKLGFSKPWPEAMTMITGQPKMSAQPLMQYFQPLIQWLEA
ENNKNNDIRGWPEYNWKPSMPGKAGKVDFLGMNVDSAAAIAGQWVLLVIGLVLLVATILL
AYKYRKSRKPQKSLSTMELKQKD
NT seq 3852 nt NT seq  +upstreamnt  +downstreamnt
atgggcactggtgtggacaggtttctgtggtctgtgctgctgctgctgccagtcctggga
ctgtgtgtggctctgccagcaacctggctgccaggggaatatacaaataccacggatgat
gcactaaggttcctcagtgactacaacagcactgctgaggaggtgttatttcacagcgtt
tctgccagctggaactacaacaccaacataacagagcacaactccatgcttcaggtaaat
gcagcccttgaagagcaagcattctcagaagcctgggggttaaaggccaagcaggtcttc
acacgtgagcttctcaactctctttccagcagtgacaagaaattgatggaaaagatcatg
atgctaggagctgccaacctgctccagaaagaaagagaggagtacaacaccattctcagc
actatggacaatatttattcaacatccaaggtgcatccagagccaaacgtaagctggagc
ttggaaccccatctcacagatatcatggccaactccaggagctacaagaggctgttgtat
gtctgggagggctggcacaatgcatcaggtgtacctctcaagcagtactaccccaggttt
gtggagctcagcaacaaagcctcccaagctgatggatttgcggacactggagctgactgg
cggtcttggtatgagactgagacctttgagcaggatttagagaaactctacaggaccatt
gagcccctctaccagaacctgcatgcctttgtgcgccgccagctctacaaccaatatggt
cctaagtacatcaatcttaaaggacctatccctgcccacctgctaggaaatatgtgggcc
cagacctggaataatatttatggtatgatgatcccatttcctgacaaacctaacatggat
gtgactgatgaaatggtcagacaaggctacaatgccacacacatgtttcgtgtggccgag
gagttcttcacctctctggatttagagccgatgcctcaggagttctgggatgagtccatg
ctggtgaagcctgaaggtcgggaggtggtgtgccatgcatctgcctgggacttttacaac
cgcaaagacttcaggatcaagcagtgcaccacagtgacgatggagcagctcttcactgta
caccacgagatgggtcacatccagtattacctgcagtacaaggaccagcctgtaggctac
cgtcgtggagccaaccctggttttcatgaggctatcggcgatgttttgtctctgtccgtt
tccacacccaagcatctgcataccattaatctactggaatctgtgacctctgatgctgaa
accgatatcaactacctgttgaagatggctctggagaagattgccttcttgccctttggc
tatctcattgaccagtggagatggggcgtcttcagtggaagcactcctaaggagcggtac
aactctgactggtggtacctcaggacaaaatatcaaggtatttgcccacccaccagacgt
acagaggagcactttgatgctggggcaaaataccacatccctggaaacacaccatatatc
aggtattttgtcagcttcatcctgcagttccagtttcatgaaaaactatgcgaagcagcg
aaacacactggtcctttgcacacatgtgacatctaccgctccaaagaagcaggcgccatc
ttaaagaaagttctccaggctggctcttccaaaccttggcctgatgtgcttcaggaggca
atagggaccaacaaaatggatgctagctcactgatgaaatactttgaccctattattaag
tggctggaaaagcaaaatgtaaatgagaccttgggatggcctgacttcgactgggtccca
cccatccctgagggctaccctgaagatatcagcaaaaatacagatgagcttgatgctaag
aagtttctggatgagtacaacaccacagctgaagtggtgtggaatgcatatactgaggcc
tcctggaagtacaacacagacatcaatgaagccaataagcaggcgatgcttgagaagaac
ctggagatgtcagcccacaccctgagatatggacagaaggcccgtcagtacgacaccact
gacttccaggacccctcagtcaaacgcatcatcaaaaaactcagcgacattgagcgggct
gcactgtccccggcagagctggaagagtacaatactctgctgtccaacatggagaccaag
tacagtgtggctgaggtctgcagagatgatgggacttgccacccactggatccagatctc
cagaagataatggcagagtccagggattatgatgaactgttatttgcgtggaagggatgg
agagattctgctggaaaagtacttcgtcaggattacaagagatatgttgaactggccaac
aaagcagcaacactcaatggtcaccctgataatggagctttctggcgctccttgtatgag
acccctacctttgaagaagacctggagtccctgtggaaggagctggagccgctttatcag
aacgtgcatgcttatgttcgtagagctttgtacaaaaaatatggtcctgagtacatcaac
ctgaagggacccatccctgctcatttgctgggcaacatgtgggcacagacgtggtctggc
ataatggatcttgtcatgccctacccagatgccacgcaggttgacgccacaccggccatg
gtggcaaagggctggaatgccaccaggatgttccaggaatcagacaattttttcacctct
cttggtttgctaccaatgccaaaagagttttgggataagtccatgctggagaagccgtct
gacgggcgccaggtggtgtgccatgcctcagcatgggacttctacaaccgaaaagacttc
aggatcaaacagtgcactgttgtgactatggatgacctgatcacggtgcaccacgagatg
ggccacgtccagtacttcctgcagtacaaagaccagcctgtgtccttccgtgatggagcc
aaccctggattccacgaggcaatcggcgatgtactagccctttctgtgtctacacccaaa
catctgcagagcattggcctcttggacaaagttgagaacaaccatgagagtgatatcaac
ttcctgatgagcatggcacttgacaagatcgccttcctaccttttggctacctgatggac
cagtggagatggaaggtatttgatggacgcatcccatcgacagagtacaataaagagtgg
tggaacctcagaatgaagtaccagggtctgtgtccacctgtaacccgcactgaagatgac
ttcgacccaggtgcaaagtttcacatccctgctaacgtgccctacgtcaggtactttgtc
agcttcgtcatccagttccagttccacaaagctctgtgtgatgctgccaatcatgttggg
cctctccacacctgcgatatctacaaatctaaagaagctgggaagctgctgggtgacgtg
atgaagctgggcttcagtaagccctggcctgaggctatgaccatgatcactggccagccc
aaaatgagtgcccagccactcatgcagtatttccaacctctcattcaatggctggaggca
gagaacaacaagaacaacgatatccgcgggtggcctgagtacaactggaaacctagtatg
cctggtaaagctggtaaagtggacttcctgggtatgaatgtggacagcgcagctgccata
gctggccagtgggtcctattggtcattggcctggtcctcttggtggccaccatcctattg
gcctacaagtataggaaatcaaggaagcctcaaaagtccctctccacaatggagctcaag
caaaaggactag

DBGET integrated database retrieval system