KEGG   Leuconostoc citreum: LCK_01367Help
Entry
LCK_01367         CDS       T00663                                 

Definition
(GenBank) DUF557 domain-containing protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
lci  Leuconostoc citreum
Pathway
lci00620  Pyruvate metabolism
lci00680  Methane metabolism
lci01100  Metabolic pathways
lci01120  Microbial metabolism in diverse environments
lci01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lci00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LCK_01367
  Energy metabolism
   00680 Methane metabolism
    LCK_01367
Enzymes [BR:lci01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     LCK_01367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2 PEPcase
Motif
Other DBs
NCBI-ProteinID: ACA83191
UniProt: B1N089
LinkDB All DBs
Position
1434902..1436419
Genome map
AA seq 505 aa AA seqDB search
MTERKIPTIMGTQHPDNANAPFWDSSQQPFISAYREMNEAFENFSELNVDEYMWDWEGKH
ADAAVIDRLFSTEYDYFKTNQIGRDKFLTFRFPNIWEEKGYNLMQAMTAILSSEDFAHDL
GFAQRPLFETILPMAQRADQLIEMQVLFEKLANFKSVEFTRSDKNTPYIEMIPLFEDFDT
QLHAPEILKEYLQLHEKHFGFRPKYLRVFLAGSDSALTAGFMSSITGNKLAIARLHEFAR
EENIEIYPISGTGSAIFRGGLSPKRIDRYIKEFPGVRTATVQSAFRYDFPIEDVQSAISE
LKAKLPVVEPLQISAEDQTILAEVAEESAAFYAHTLDQLVPDMQPIFKAFPKRRDRRQHV
GVLGYSRSVDGIELPRAINFTGAFYSIGVPPEFIGFGRALENLNADHLSALVRNYPSMKK
DFQELSHYVNLDALEVLKTQSPAWAEVERDIMILKAIFNLEVGPQTREEQQHAEIALQVV
QIKDGAPIAVTALINRMAQLRHFLG
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaagaaaaatcccaacaattatgggtacacaacatccagataacgctaatgca
ccattctgggattcttctcaacaaccttttatcagcgcttaccgtgaaatgaatgaagct
tttgaaaatttcagtgagctaaacgttgatgaatacatgtgggattgggaaggcaagcac
gctgatgcggctgtcattgaccgtttgtttagcaccgaatacgattactttaaaacaaat
caaattggtagagataaatttctcactttccgatttcctaacatctgggaagaaaaaggc
tataatttaatgcaggccatgaccgcaattctcagttcagaggattttgcacatgactta
ggctttgcacaacgaccattatttgaaacaattttaccaatggcgcaacgtgcggatcaa
ttaatagaaatgcaagtgctttttgaaaagctggctaactttaaatcagttgaatttaca
agatcagataaaaatacaccatacatcgaaatgattccattatttgaagatttcgataca
caactgcatgcacctgaaattctaaaagaataccttcagctccatgagaagcactttggt
ttccgtcctaagtatcttcgtgtcttcctagctggttctgattcagcattaacggctggt
ttcatgagttcaatcacaggaaacaaattggccattgcacgtctgcatgaatttgcgcgc
gaagaaaatatagaaatttatccaatttctggtacaggatctgctattttccgtggtggc
ttgtcaccaaagcgtattgaccgctacattaaagaattcccaggtgtgagaacagcgact
gtccaatcggcttttcgctatgattttcccatcgaggacgttcaaagtgccatcagtgaa
ttgaaagcaaaattaccggtcgtagaaccattgcagatctcagccgaagatcaaacgatt
ttggccgaggttgctgaagaatccgcggccttctacgctcatacgttagatcagctggtg
cctgatatgcaaccaatctttaaggcctttcctaagcgtcgtgaccgtcgccaacacgtg
ggtgttctaggctattctcggtcagttgacggtatcgaattacctcgtgcgattaacttt
actggcgccttttattccatcggtgtcccaccagaatttattggtttcggtcgtgcatta
gaaaacttaaacgccgatcatctatccgcacttgtacgtaattatcctagcatgaaaaaa
gatttccaagaactatcacattatgtcaatctcgatgcacttgaagtgcttaaaactcaa
agtcctgcttgggctgaggttgaacgtgatattatgattctaaaagctatttttaacctt
gaagttggcccacaaaccagagaagaacaacaacacgcagaaatagcgctacaagtcgtt
caaatcaaagatggtgccccaattgctgtcacagcattaattaatcgtatggcacaactt
cgtcatttcttaggttaa

DBGET integrated database retrieval system