KEGG   Latimeria chalumnae (coelacanth): 102352257Help
Entry
102352257         CDS       T02913                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  
prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
Arachidonic acid metabolism
Metabolic pathways
VEGF signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    102352257 (PTGS2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    102352257 (PTGS2)
Enzymes [BR:lcm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102352257 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 620 aa AA seqDB search
MDFKSRQKAFIIPTRMFIYGTLLFVCVSLSHAANPCCSNPCQNRGVCMTVGFDNYECDCT
RTGFYGKNCTTPEFWTWVKRALKPSPNTVHYILTHYKGFWNIVNSIPFLRDAIMRYVLTS
RSHLIDSPPTYNSHYDYKSWEAYSNLSYYTRTLPPVPEDCPTPMGVKGKNSLPDSKMIAE
KFLLRRKFIPDPQGTSLMFAFFAQHFTHQFFKTDQIRGPAFTTGLGHGVDLNHIYGETLD
RQHKLRLFKDGKLKYQMINGEMYPPTVKDVQVAMTYPPHIAEDFKFAVGQEVFGLVPGLM
MYSVIWLREHNRVCDILKQEHPEWDDERLFQTTRLILIGETIKIVIEDYVQHLSGYHFKL
KFDPELLFHQQFQYQNRIAAEFNTLYHWHPLMPDSFLIQGKEYGYHQFLFNNSIVTEHGI
RNLVESFSKQIAGRVAGGRNVAPGVLRVAIASIDQSRKMRYQSLNEYRKRFQMRPYKSFE
DLTGEKEMAAELQELYGDVDAVELYPGLMVEKPRPGAIFGETMVEMGAPFSLKGLIGNPI
CSPEYWKPSTFGGNVGFQIVNTASLQKLVCSNVKGTCPFTSFHIPEPNPTKTSTSNASTS
NSALKDINPSLLLKKHSTEL
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atggatttcaaaagtagacaaaaggcctttatcattcctacaaggatgttcatttatgga
actttactatttgtttgcgtatctctcagccatgcagctaatccttgttgctccaaccct
tgtcagaataggggtgtatgtatgactgtaggatttgacaactatgaatgtgattgtact
agaactggattttatggaaagaattgcacaactccggaattctggacctgggtgaaaagg
gctttgaaacccagccccaatactgttcattacatcctcacacattataaaggattttgg
aacattgtgaacagtataccattcctcagagatgctatcatgcgatatgtgctaacatcc
aggtcacatttgatagacagcccacctacctacaatagtcattatgactataaaagttgg
gaagcgtactccaatctcagctattacactagaacacttccaccagttccagaggactgc
ccaactcctatgggagtcaaaggtaaaaattccctgccagattccaagatgatagcagag
aaatttctgttacggagaaagttcattcctgatcctcagggtaccagcctcatgtttgct
ttctttgctcagcattttactcaccagttcttcaaaacagaccaaatacggggccctgcc
ttcactacgggacttggacatggtgttgacctgaatcatatctatggggaaactttggac
agacagcacaagctcagactttttaaagatggaaaactgaaatatcagatgatcaatgga
gagatgtaccctcctactgttaaagatgtccaagtagccatgacttaccctccccacatt
gcagaggactttaagtttgctgtgggccaggaagtctttggcctcgtccctggactaatg
atgtattcagtaatctggcttagggagcacaacagagtttgtgacattcttaagcaggaa
catccagaatgggatgatgaacgtctgttccagacaactagactgattctaattggtgaa
accattaaaattgtgattgaagactatgtgcagcatctgagtggttatcacttcaagctg
aagttcgacccagaattgctattccaccagcagttccagtaccaaaatcggattgctgcc
gagttcaacactctgtaccactggcacccactcatgccagactcctttctgatccagggc
aaggagtatggctaccatcagttccttttcaataactcaattgtcactgaacatgggatc
agaaacctggtggagtctttttctaagcagattgctggcagggttgctggtggaaggaat
gttgcacctggagttctgagagtagctatagcttctattgaccagagcagaaagatgaga
taccaatccctgaatgagtaccgaaaacgtttccaaatgaggccttataaatcttttgag
gatctcacaggagagaaggaaatggctgcagaactccaagaactttacggagacgtagac
gctgtggagctataccccggcttaatggtagagaagcctcgccctggtgctatctttgga
gagaccatggtagaaatgggtgccccattctccttgaagggcctgataggaaatcctatc
tgctcccctgaatactggaaaccaagtacctttggcgggaatgtgggctttcagattgtg
aatactgcttccttacaaaaacttgtttgtagcaatgtaaagggcacttgcccctttacc
tcatttcacattccagagcctaatcccacaaaaactagcacaagcaatgctagcacctca
aactctgcactgaaagacatcaacccaagtttactactgaaaaaacattcaacggaatta
taa

DBGET integrated database retrieval system