KEGG   Latimeria chalumnae (coelacanth): 102355071Help
Entry
102355071         CDS       T02913                                 

Gene name
LIG3
Definition
(RefSeq) DNA ligase 3
  KO
K10776  
DNA ligase 3 [EC:6.5.1.1]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
Base excision repair
Module
BER complex
Brite
KEGG Orthology (KO) [BR:lcm00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    102355071 (LIG3)
Enzymes [BR:lcm01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     102355071 (LIG3)
DNA repair and recombination proteins [BR:lcm03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     102355071 (LIG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 1042 aa AA seqDB search
MLGLWRLLFRYTAPSLSRKEAVKSKPTAKFSLSCWIIGSVARPFHCSGLLCQNPHRSRIC
FISLFGWSSGCSFLRPAICLVPSSVRAKTSDMAEQRYCVDYAKRGTAGCKKCKDKIAKGM
VRIAKVVPNPFTESGGDMKEWYHVKCMFEKLERARATTKKIEDLTELEGWQELQDAERDL
INQHITELANKTATTPKKKVTVQAKLSPAGQVISSSKLPTAGPSSAPRKFPGFTATKAES
TDDAPSTDGPSAQSCDLSHKDCSLREFRKLCANIADKPSYNVKTQIIQDFLYKGAGGDGF
HGDTYLTVKLLLPGVIKSVYNLNDKQIVKIFSKIFNCNLEEMVQDLEQGDVSETVRIFFE
ASCTFLAAAKSTLSIQEVDAFLQHLSKLTKEDDQQRLLQDMASRCTANDLKCIIRLIKHD
LKMNAGAKHVLDALDPNAYEAFKASRNLRNVVERVLKNQQDEEKMPGMKRSLSVKASLMT
PVQPMLAEACKSIEYAMKKCPNGMYAEIKYDGERVQVHKSGESFSYFSRSLKPVLPHKVA
HFKDFIPKAFPGGNSIILDSEVLLIDTNTGKPLPFGTLGVHKKAAFQDANVCLFVFDCIY
FNGVSLMDRPLIERRKFLHDNMVEIPHRILFSEMKHVTKASDLADMITRVIREGLEGLVL
KDTKSLYEPGKRHWLKVKKDYLNEGAMADSADLMVLGAFYGQGSKGGMMSIFLMGCYDPS
CGKWCTVTKCAGGHDDATLARLQNELDMVKISKDPSKIPSWLKINKNYYPDFIARDPKKA
PIWEITGAEFSKAEAHTANGISIRFPRCTRIRDDKDWQTATNLQQLQELYRVSKETLDTN
LLTSLSKGTDDSSGGSNGDTEDSSKPSTPGISKPSSSRGSSKGSTAKSPGKEQKKPKSQQ
GTSSSAWKSPTEEGVDPTAGKGVKRKLITPEQNGKKMKLSGPVSSGEKTKSSSLSAQSIA
SSQHKTLLDIFTGVRLYLPPSVEDFSKLQRYFIAYDGDLVPEFDTSGATHTVSDLEGNSN
AKRVSPNWIWECVKKRRVVPPC
NT seq 3129 nt NT seq  +upstreamnt  +downstreamnt
atgcttggtctgtggaggttgctgttccgatacactgctccaagcttgtccagaaaggag
gctgttaaaagcaaacctacggcaaaattctccttaagctgttggatcattggatctgtg
gcacggccctttcattgttcaggtttgctgtgtcagaatccacatcggagtagaatctgc
ttcatttctttgtttggctggagttctgggtgtagcttcctcagacctgccatctgcttg
gtgccaagcagtgtgcgtgcaaagactagtgacatggcggagcagcgatactgtgtggac
tatgccaaacggggcacagcaggctgcaagaagtgcaaagacaagattgcgaaggggatg
gtgcgtattgcaaaggtggtccccaaccctttcaccgagtctgggggggacatgaaggag
tggtaccatgtgaagtgcatgtttgagaagctggagagggcacgggccacaaccaagaaa
attgaggatctgactgagctggaaggatggcaggagcttcaggatgctgagcgggacctt
atcaaccagcacatcacagaactggctaataaaacagccaccaccccaaagaagaaagtg
actgtccaggccaaactgtcacctgctgggcaggtcatctcctccagcaagttaccaaca
gctgggcccagttcggcaccacggaagtttccaggatttacagcaacaaaggcagagtca
acagatgatgctccttccactgatggaccatctgcacagtcatgtgacctgagccacaag
gactgctcactgcgagagttccggaagctgtgtgccaacattgcggacaaacccagctac
aatgtgaagacccagatcatccaggacttcctgtacaagggggcaggcggagatggcttc
catggagacacatatctgacagtgaaactgctgttgccgggggtgattaagagtgtttac
aacctgaatgataaacagattgtcaaaatctttagtaaaatctttaactgcaacttagaa
gagatggtgcaagatctggaacagggtgatgtttctgagactgttcggatcttctttgaa
gctagttgtacctttctggcagctgctaagagcacgctttctatacaggaggtggatgcc
ttcttacaacatctgtccaaactaaccaaggaggatgaccagcagaggttactacaggac
atggcctccaggtgcacggcaaatgacctgaagtgcattatccggttgatcaaacatgat
ctaaaaatgaatgctggggctaaacatgtgctggatgcattggacccaaatgcctacgag
gcatttaaagcttcccgtaaccttcggaatgtggtggagcgtgtgctgaaaaatcaacag
gatgaagagaagatgccagggatgaagcgatcactaagtgtgaaggcatcccttatgacc
cctgtccaaccaatgttggcagaggcctgcaagtccattgagtatgccatgaagaagtgt
ccaaatgggatgtacgctgaaatcaaatatgatggagaacgagtgcaggtgcacaagagc
ggagagagcttcagctacttcagccgtagcctgaagcctgtactcccccacaaggttgct
cactttaaagattttattcccaaggcctttcctggtgggaacagcataattttggactct
gaggttcttctgattgacaccaatactgggaagcccctcccctttggaaccctgggcgta
cataagaaagctgccttccaggatgccaatgtctgcctgtttgtctttgactgtatctac
tttaatggagtcagcttgatggacaggcctctcattgagcgacggaagttcctccatgac
aacatggtggagattccccaccggattttgttctcggagatgaagcatgtcactaaagct
tcggaccttgcagatatgattacacgggtgatccgagagggcttggaaggactggtacta
aaggatacaaagagtctatatgagccaggcaaacgacactggctgaaggtgaagaaggat
tacctgaatgagggagccatggcggacagtgctgacttgatggtgctgggagctttctat
gggcaaggaagcaaaggcggaatgatgtccatcttcctcatgggctgctacgatcccagc
tgcggaaagtggtgcacagtgaccaagtgtgctggtggccatgatgatgccacgttggcc
cgactacagaatgaactggacatggtgaaaattagcaaagatcccagtaaaattcccagc
tggctgaaaatcaacaaaaactattatccagactttatcgcccgagacccaaagaaagcc
ccaatatgggagatcacaggagctgaattctcaaaggctgaagcacacactgccaatggc
atctccattcgcttccccagatgtactcgtatccgtgacgacaaggattggcagaccgca
accaacctacagcaacttcaggagctgtaccgagtgtccaaggagacgttggatacgaat
ctgctgactagcttatcaaaggggactgatgactcctctgggggcagtaatggagacact
gaagacagctcaaaaccctccactcctggcatctccaaaccatctagttcccggggctcc
tccaaagggtccacagccaagtcaccaggcaaagagcaaaagaaacccaagagccagcaa
ggtaccagtagctcagcctggaagtctcccactgaagaaggggtggacccaactgctgga
aaaggggtgaagaggaaactgataacgccggagcaaaacgggaaaaagatgaaattgtcc
ggacctgtgagcagtggtgagaagaccaagtcctcatctttgtcagcccagtccatagca
tcttcccaacacaagacgctgttggacattttcacaggggtcagactgtacctgccgcca
tcagtagaggacttcagcaaactgcagcgctatttcattgcttacgatggtgaccttgtc
ccagagtttgacacttctggtgccacgcacacagtgagtgacctggagggaaactccaat
gccaagcgagtctcccccaactggatttgggagtgcgtgaagaagcgccgtgtggttcct
ccctgctga

DBGET integrated database retrieval system