KEGG   Latimeria chalumnae (coelacanth): 102356679Help
Entry
102356679         CDS       T02913                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
lcm  Latimeria chalumnae (coelacanth)
Brite
Enzymes [BR:lcm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     102356679
Peptidases [BR:lcm01002]
 Metallo Peptidases
  Family M2
   102356679
Exosome [BR:lcm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102356679
CD molecules [BR:lcm04090]
 Proteins
  102356679
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 1283 aa AA seqDB search
MTYQIFWLLVFPLLSLALDNSYLPQNYTKNKMGALQFVSDYNSTGEEVFFKSVSASWDYN
TNLTTYNQEKQINASLEEQEFSAVWGASAKTFDDILETFPTSLKRLIRQIRVLGVANLKV
EERQKYNTLLSQMDNIYSTAKVCPPNQSTGCWSLEPDLVNLMATSRNYKKLLYAWEGWHN
AAGVPLREKYKEFVTISNIAYQRDNFSDTGDFWRSWYESSEFENDLEKIYQQLEPLYLNL
HAFVRRKLYQRYGAKYINLRGPIPAHLLGNMWAQQWNNIYDMMIPFPQKTNVDVTDAMIK
KNWNATHMFKVSEEFFTSLGLLGMPQEFWDHSMLEKPKDGREVVCHASAWDFYNRKDFRI
KQCTTVTMEQLFTVHHEMGHVEYYLQYKDQPITFRGGANPGFHEAIGDVLALSVSTPKHL
KEIDLLSQFTNDTESDINYLLKMALEKIAFLPFGYLIDQWRWGVFSGRITPQDYNYEWWY
LRTKYQGICPPVARSAIHFDPGAKYHIPANTPYIRYFVSFILQFQFHKALCKAAGHTGPL
HTCDIYKSKIAGAELSKVLQAGSSKPWQEILEGLTGERHMNAGPLLEYFQPVTDWLKEEN
RKCNETLGWPEFEWRPPVPDGYPGDIDKIADEAQAQEFLAEYNRTAEKVWNAYSEASWTY
NTNITEHNKQIMLQKSLEMSKHTLEYGTRAHKFDYTDFLDGSSKRILKKLSELDKAALPE
EELKEYNNILSQMETTYSVAKVCRDDGKCHPLDPDLTEIMATSRNYSELLFAWKGWHDAS
GKKIRKDYEKYVEFSNKAARLNGHPDNGAFWRSLYESPTFEADLEKLYHQLQPLYLNLHA
YVRQALHRKYGDKYINLKGPIPAHLLGNMWAQSWLSIYSLLVPYPEATQVDATPAMIAQK
WNAERMFKESDNFFTSLGLIPMPQEFWDKSMIEKPTDGREVVCHASAWDFYNRKDFRIKQ
CTVVNMDDLITVHHEMGHIQYFLQYKDQPISFRDGANPGFHEAIGDVLALSVSTPKHLHS
IGLLDTVNENYESDINYLMSIALDKIAFLPFGYLMDQWRWKVFDGRILKENYNREWWNLR
LKYQGLCPPVPRTEDDFDPGAKFHIPANVPYVRYFVSFIIQFQFHEALCKATKQTGPLHK
CDIYKSNAAGKLLGDALKLGFSKPWPEAMTLITGQPNMTAEALMKYFEPLTKWLIKQNEK
NRVTLGWPEYDWTPDNLQTASPNNNGDKVDFLGMTLNSSQAAAGQWILLVIGLGLVIATI
VLAVKFTSMKRQTKKSSSELELK
NT seq 3852 nt NT seq  +upstreamnt  +downstreamnt
atgacataccagatcttttggttactggtgtttccactgctatctctagcccttgacaat
agttacctgcctcagaactacaccaaaaataaaatgggggccttgcaatttgtcagtgac
tacaacagcactggggaggaggtcttctttaaaagtgtatctgcaagttgggattataac
acaaatctgactacatacaaccaggaaaaacagatcaatgcatctttagaggagcaagag
ttctctgcagtttggggtgcatcagccaagacatttgatgacattttggaaaccttcccc
acttcgctaaagaggctcattagacagattagagtcctaggagtggctaacttaaaagta
gaagaaagacaaaagtacaacactttattgagccaaatggacaatatttactccactgct
aaagtgtgtccaccaaatcaaagtactggctgctggtccttggaacctgatctggtaaac
ctgatggccacttctcggaactacaagaagctgctgtacgcttgggagggctggcacaat
gctgcaggggtaccactgagagagaaatataaagagtttgtcaccataagcaacatagcc
taccagcgtgacaattttagtgacactggggatttctggcgctcatggtatgagtcttca
gaatttgaaaatgaccttgagaagatttatcagcaactggaaccactgtacctgaacctg
catgcatttgtaaggaggaagctatatcagcgctatggtgctaagtacattaacctaagg
ggacccattcctgcccacttattaggtaacatgtgggctcagcaatggaataacatctat
gacatgatgattccattcccacaaaaaacaaacgtagatgtcacggatgctatgattaag
aagaactggaatgctacccatatgttcaaagtttctgaagagttcttcacctctcttgga
ctgctgggaatgccacaggaattctgggatcactccatgctagaaaagccaaaagatggg
agagaggtggtgtgccatgcttctgcttgggatttctataacagaaaagacttcagaata
aagcaatgtaccactgtgacaatggagcaactctttactgtccaccatgaaatgggccat
gtggagtattacctgcagtacaaggaccagccgattacatttcgtgggggggccaaccca
ggcttccatgaggccattggggatgtgctggcactgtcagtgtccaccccaaaacacttg
aaagagattgacttactgtcacagttcactaatgatacggaaagtgacatcaattatctt
ctgaagatggctcttgagaaaatagccttcctaccttttggttacctgattgaccaatgg
cgttggggggtgtttagtggacgcatcacccctcaagactacaattatgagtggtggtac
ctcaggacaaaataccagggaatctgtcccccagttgcacgcagtgcaatccactttgac
cccggtgcaaaatatcacatccctgccaacactccgtacatcagatattttgtgagtttc
attcttcagttccagtttcacaaggcactatgtaaagcggcaggtcatacaggcccatta
cacacctgtgacatctacaagtccaagatagcaggagctgagctcagtaaggttctacag
gctggttcctctaaaccatggcaagaaatcctagagggtctaacaggggaacgtcacatg
aatgctggtcccctcttggagtactttcaacctgtcactgattggctaaaagaagagaat
agaaaatgcaatgagactctgggctggcctgagtttgagtggcgcccaccagtacctgat
ggttaccctggagatattgacaaaattgcagatgaagcacaagcccaagagtttctggca
gagtataacagaacagcagagaaagtgtggaatgcctacagtgaggcatcctggacatac
aacaccaacatcactgaacataacaagcagataatgcttcaaaagagcttggagatgtcc
aaacataccttggaatacggcactcgtgctcacaagtttgactacactgacttcttggat
ggtagtagtaaacgtattctgaagaaactgagtgaactagacaaggcagcactgcctgag
gaggaattaaaagagtacaataatatcctgtcacaaatggaaacaacatacagtgttgcc
aaagtttgccgagatgatggaaaatgccatccattagatccagatctaactgagattatg
gccacttcaaggaattacagtgagctgctctttgcttggaaaggttggcatgatgcttca
ggcaagaaaatccgtaaagactatgagaaatatgtggaatttagcaacaaggcagcaaga
ctgaatggccatccagataatggagccttttggcgatccctttatgagtctccaactttt
gaagctgacctggaaaaactctatcatcagctacagcccctgtacctcaacctccatgct
tatgtccgtcaggcactccacagaaaatatggtgacaagtatatcaatcttaaaggtccc
attcctgctcatcttttaggaaacatgtgggcccagtcatggttgagtatttacagtctc
cttgtgccatacccagaagccacccaggtggatgctacacctgcaatgattgctcagaag
tggaatgcggaaagaatgttcaaggagtctgacaacttttttacctcccttggactcatc
cccatgccccaagaattctgggacaaatccatgattgagaagccaacagatgggagggag
gttgtgtgccatgcctctgcttgggacttctacaacaggaaagacttcagaattaagcaa
tgtactgtcgtcaacatggatgacctcatcactgtccatcatgagatgggacatattcag
tatttcctgcagtacaaagaccaacccatctcctttcgagatggtgcaaaccctggtttc
catgaggcaatcggtgacgtcctagcactatctgtctccaccccaaaacaccttcacagt
attgggctacttgacacagtcaatgaaaattatgagagtgacattaactatctaatgagt
attgccctggataagattgcattcctgccctttgggtatctcatggatcagtggcgatgg
aaggtgtttgatggacggattttaaaagagaattacaatcgagagtggtggaacctgagg
ttgaagtaccagggtctgtgccctcctgtgccaaggactgaagatgactttgatcctggt
gcaaagttccacatcccagctaatgttccatatgtcaggtattttgttagcttcataatc
cagttccagttccatgaggctctgtgtaaggcaaccaagcaaacgggtcctcttcacaaa
tgtgacatctacaagtcaaatgctgcaggcaagctgctcggtgatgctctgaagctaggg
ttcagcaaaccctggccagaggcaatgactctcatcactggacagcctaacatgacagct
gaggctctgatgaagtattttgaaccactgacaaagtggcttattaaacagaatgaaaag
aatagagtgaccctgggctggcccgaatacgattggactccagacaaccttcagacagct
tctcccaacaataatggtgacaaagtggatttccttggcatgacactaaacagcagtcag
gctgcagctggacagtggatcctactggtcattggacttggccttgtcattgccaccatt
gtcttagcagtcaagttcacctctatgaaacgacaaaccaaaaagtcctcttcagaactg
gaactgaaataa

DBGET integrated database retrieval system