KEGG   Latimeria chalumnae (coelacanth): 102357880Help
Entry
102357880         CDS       T02913                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  
histone deacetylase 4/5 [EC:3.5.1.98]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:lcm00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    102357880 (HDAC4)
Enzymes [BR:lcm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102357880 (HDAC4)
Chromosome [BR:lcm03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     102357880 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
Un
AA seq 1089 aa AA seqDB search
MSSPSHPDGVSSCDQSVELLKPSRVNHIPGTVDVSAARPLQVAPNTAPMDLRLDHQFSVP
VAESTLRDQQLQQELLALKQKQQVQRQLLIAEFQRQHEQLSRQHEAQLHEHIKQQQELLA
MKHQQELMEHQRKMEQHRQEQELEKQQREHKLQQLKNKEKGKESAVASTEVKMKLQEFVL
NKKKALAHRNLNHCMSSDPRFWYGKTQHSSLDQSSPPQSGVSASYNHPVLGMYDPKDDFP
LRKTASEPNLKVRSRLKQKVAERRSSPLLRRKDGPGVTILKKRPLDVTDSVCNSAPGSGP
SSPNNSSNNISTENGIAGSVTNIPVEPNLVHKLVTREGSVTQLSLYTSPSLPNITLGLPA
STPSSVSDKAASGQQEAERLAIPALQQRLQLFPGSPLTPYLSSAALERDGGTNHNPLLQH
MVLLEQSAAQNPLVTDWYLSGLGTLPLHAQSLVGTERVSPSIHKLRQHRPLGRTQSAPLP
QNAQALQQLVIQQQHQQFLEKHKQQFQQQQLHLNKMIPKANEPARQHESHPEETEEELRE
HQALVEDPYGDQSTGQKERRVLNLVKGVQVKQEPIESDGEEAEQQQMEQEKRQTDQDLLF
RQQALLLEQQRIHQLRNYQASMEATGMSVTFGGHRPLSRAQSSPASATFPITVQEPPAKP
RFTTGLVYDTLMLKHQCTCGSTNSHPEHAGRVQSIWSRLQETGLRSKCECIRGRKATLEE
LQTVHSEAHTLLYGTNPLNRQKLDSSLTPMFVRLPCGGVGVDSDTIWNEVHSSSAARLAV
GSVVELVFKVASRELKNGFAVVRPPGHHAEESTPMGFCYFNSVSIAAKLLQQRLNVSKIL
IVDWDVHHGNGTQQAFYNDPSVLYMSIHRYDDGNFFPGSGAPDEVGTGAGVGFNVNMAFT
GGLDPPMADAEYLAAFRTILMPIANEFAPDVVLVSAGFDAVEGHPAPLGGYKVSAKCFGY
LTNQLMGLAGGRVVLALEGGHDLTAICDASEACVSALLGNELEPLPQDVLQNRPNSNAVV
SMERVIEIQSKYWPCVQRYSSSVGLSLIEAQKRETEEAETVTAMASLSMGVKPADRRPED
EPMEEEPPL
NT seq 3270 nt NT seq  +upstreamnt  +downstreamnt
atgagctccccaagtcacccagatggagtgtccagctgtgaccagtctgtggagctgctg
aagccatcccgagtcaatcacattcctggtaccgttgatgtgagcgcagcacggcccctg
caagttgcacccaacactgcccccatggatctccggttggaccaccagttctctgtgcca
gtggccgaatccacactccgggaccagcaactacaacaggagctcctggccctgaaacag
aaacaacaagtccagcggcagctccttattgccgagtttcagagacaacatgagcaactg
tcccgccaacatgaggcccagctccatgagcacatcaagcagcaacaggagttgttagcc
atgaaacaccagcaggagctgatggaacaccagcggaagatggagcagcatcgacaggaa
caagagctggagaaacagcagagagagcacaagctacagcagctcaagaacaaggagaag
ggaaaagaaagtgccgtggccagtactgaggtaaagatgaagctacaggaatttgttctg
aataaaaagaaagcattggcccatcggaatttgaaccactgcatgtccagcgacccccgc
ttctggtacgggaaaacacaacacagttctctggaccagagctctcctccccaaagtggg
gtgtcagccagttataatcacccagtgttggggatgtatgaccccaaagatgatttccct
ctaagaaagacagcgtctgaacccaacttgaaagtgcgttccaggctaaaacagaaggtg
gcagagaggagaagcagccccttgctacggaggaaagatggtccaggggttactattctt
aaaaagcggccactggatgtaactgactcagtgtgtaacagcgcccctggctctggcccg
agctctcctaacaacagctccaataacatcagtacagaaaatggaattgctggatcagtg
accaacatcccagtagagcccaatttggttcacaagctggtgactcgggaagggtcagtg
acacagctgtctttgtatacatccccctcactgcccaatatcacacttggactgcctgcc
agcacgccatccagtgtaagtgacaaagctgcctcgggacagcaggaggcagagagactg
gccatccctgccttacagcagcgtttacagctcttccctggctcccccctgaccccctac
ctgagcagcgcagcactggagagggatggcggaactaatcacaacccgcttctacaacac
atggttctactggaacagtctgcggcacagaaccccctggttactgactggtatctttca
ggcctcgggacattgcccctccacgcacaatccctggtgggcacagagcgggtgtctccc
tccatccacaagctgcgtcagcaccggccgttggggcggacgcagtcggcgcccctccct
cagaatgcgcaggccctgcagcagttggtgatacagcagcagcatcagcagttcctggag
aaacacaaacagcagttccagcaacagcaacttcacctcaacaagatgattcctaaagca
aatgaaccagcccgtcagcacgagagccacccagaggagacggaggaggagctgcgggag
caccaggcactggtggaggatccctatggggaccaaagcactggtcagaaggaaaggagg
gtgctcaacttagtcaaaggggtgcaggtgaaacaggagcccattgagagtgatggagaa
gaggctgagcagcaacagatggaacaggagaagaggcagactgaccaggacctgctcttc
agacagcaggccctcttactggaacagcagcgtatccaccagctgaggaactaccaggca
tccatggaggcaaccggaatgtctgtcaccttcggaggccaccgcccactctcccgtgca
cagtcctctcctgcctctgctacattccctatcaccgtccaggagccgcctgctaaaccc
aggttcaccacaggtctggtctatgacacccttatgctgaagcaccagtgtacctgtggc
agcacaaacagccatccagagcatgctgggagagtccaaagcatctggtctcggctacaa
gagacaggactgcgtagcaagtgtgagtgtatccgtggaaggaaggcaactttggaggaa
cttcagaccgtccactcagaagcccatacactgctttacggcacaaatccactgaaccga
cagaaactggacagttccctcacgccgatgtttgtaagactcccctgcggcggtgtgggg
gtggacagtgacacgatttggaatgaagttcactcatcgagtgcagcccggctagctgtg
ggctcagtagtagagctggtgttcaaggtggcatcaagagaactgaagaatggttttgct
gtagtgcgccctcctggtcatcatgcagaagagagcacgcccatgggcttctgctatttc
aattcggtttcaattgcagccaaactcctccagcagagactaaatgtgagcaagatcctc
attgtggactgggatgtacatcatggcaacggcacccaacaggcattctacaatgacccc
agcgtcctctatatgtcaatacatcgttatgatgatggaaactttttcccaggaagtgga
gcgccggatgaggttggcacaggagcaggtgttggttttaacgttaacatggcgttcacc
ggagggctggatccgcccatggctgatgcagagtacctggcagcatttaggacaatattg
atgccaattgcgaatgagtttgcacctgatgtggtgttggtgtcggctgggttcgatgca
gtggaagggcaccctgcccccctcggaggttacaaagtatctgccaaatgtttcgggtac
ctgacaaaccagctgatgggactggctgggggccgcgttgtgctggctctggaggggggt
cacgacctgactgccatttgcgatgcatctgaagcatgtgtttctgctttgctgggaaat
gagctggagcctctcccccaggatgtcctgcagaatcgaccgaactctaatgccgtggtg
tccatggagcgtgtcattgagatccagagtaaatactggccttgtgtgcagcgttactct
tcctccgtgggactttctctgattgaggcacaaaaacgcgagacagaagaagccgagact
gtaacagccatggcctctctatccatgggggtcaaacctgccgacagaaggccagaggac
gagccaatggaggaggagccgcccctgtaa

DBGET integrated database retrieval system