KEGG   Latimeria chalumnae (coelacanth): 102364429Help
Entry
102364429         CDS       T02913                                 

Gene name
HKDC1
Definition
(RefSeq) hexokinase domain containing 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
lcm  Latimeria chalumnae (coelacanth)
Pathway
lcm00010  Glycolysis / Gluconeogenesis
lcm00051  Fructose and mannose metabolism
lcm00052  Galactose metabolism
lcm00500  Starch and sucrose metabolism
lcm00520  Amino sugar and nucleotide sugar metabolism
lcm00524  Neomycin, kanamycin and gentamicin biosynthesis
lcm01100  Metabolic pathways
lcm01200  Carbon metabolism
lcm04910  Insulin signaling pathway
Module
lcm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lcm_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lcm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102364429 (HKDC1)
   00051 Fructose and mannose metabolism
    102364429 (HKDC1)
   00052 Galactose metabolism
    102364429 (HKDC1)
   00500 Starch and sucrose metabolism
    102364429 (HKDC1)
   00520 Amino sugar and nucleotide sugar metabolism
    102364429 (HKDC1)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    102364429 (HKDC1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    102364429 (HKDC1)
Enzymes [BR:lcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     102364429 (HKDC1)
Membrane trafficking [BR:lcm04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    102364429 (HKDC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 102364429
NCBI-ProteinID: XP_005990008
Ensembl: ENSLACG00000008562
LinkDB All DBs
Position
Un
AA seq 917 aa AA seqDB search
MFAVHLVAFYFTKLKEDQIKKVDRFLYHMRLSDDTLLDVMTRFRVEMEKGLAKATNPTAT
VKMLPTFVRSMPDGSEKGDFLALDLGGSNFRVLRVKVSEDGKQKVEMESQFYPTPEEVIH
GTGKQLFDYVAECVVNFMEKKKIKDKKLPLGFTFSFPCKQAKLDEGILISWTKNFKARGV
QGTDVVSSLRKAMLKYQDVDVDVLALVNDTVGSMMTCGFEDKYCEAGVIIGSGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDLGSINPGKQLFEKMISGP
HMGELVRLILVKMAKKGLLFKGNLSAALRTKGKFEMKHVAAIEKYKEGLRNAREILSNLG
LDPTEEDCIAVQHVCTIVSFRAANLCATTLAAILARLRENKKLRRLRTTVGMDGTVYKTH
PQFAKRLHKVVRRLAPECDVRFLLSESGSGKGAAMVTAVAYRLVSQRKQVDEALAPFKLT
KDQLCEVKKRMRTELEHGLKKETHHTASVKMLPTYVYGTPDGTERGKFLALDLGGTNFRV
LLVKIRSGLRRSVRMYNKIYAIPLWIMQGTGEELFDHIVQCISDFLDYMGMKGAQLPLGF
TFSFPCRQAGIDKGTLVGWTKGFKATDCEGEDVVDLLREAIKRRNEFDLDIVAVVNDTVG
TMMTCGYEDPKCEIGLIAGTGSNVCYMEEMRNIELMEGDEGRMCINTEWGAFGDNGCIDD
LRTQFDREVDEGSLNPGKQRYEKMTSGMYLGEIVRQILIHLTKQGLLFRGQVSERLKTRG
IFETKFLSQIESDGLALLQVRGILQQLGLDSTCDDSIIVKEVCGVISRRAAQLCGAGLAA
IVDKIRENRNLDCLEVTVGVDGTLYKLHPHFSRVLQETVKEQAPTCGVTFMLSEDGSGKG
AALITAVARRFHSNRQH
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcagtacatctggtggcgttttatttcaccaagctgaaagaagaccagatcaaa
aaggttgaccgatttctctatcatatgcgtctatcagatgacacgctcctggatgtcatg
actcggtttcgggtagaaatggagaaaggcctggctaaagctacaaaccctacggcaact
gtgaaaatgttgccaacttttgtgaggtcaatgccagatggatcagaaaagggagatttc
ctagctctggaccttggaggctccaacttccgggtgctgagagtgaaagtatcagaagat
ggaaaacagaaagttgagatggagagccagttctatccaaccccagaggaggttattcat
ggtactgggaaacaactttttgactatgtagctgaatgtgtggtgaactttatggaaaag
aagaaaatcaaagacaagaaactaccacttgggtttacattttcttttccgtgtaaacag
gccaaacttgatgaaggtatcctgatatcatggactaaaaattttaaagccagaggggtt
caaggaacagatgtagtcagctccctgcgaaaggcaatgctgaaatatcaggatgttgat
gtggatgtgctggcactggtaaatgatacagtggggagtatgatgacgtgtggatttgaa
gacaaatattgtgaagctggtgtcattataggtagtggtacgaatgcttgttacatggaa
gagttgagacacattgatctagtggaaggggatgaagggaggatgtgcattaacactgag
tggggcgcttttggagatgatgggtcactggaagatatcaggactgaatttgatagagaa
attgacttggggtcaataaatcctggaaaacaactgtttgagaagatgattagtggaccg
catatgggagaacttgtaagactcattcttgtaaaaatggcaaagaaaggtctcctcttc
aaaggcaatctttcagctgctctccggacgaagggcaaatttgagatgaagcatgttgct
gcaatagaaaagtacaaagagggtttgagaaatgctagagagatactaagcaacttgggt
ctggatcccacagaagaggactgcattgctgttcagcatgtctgcacaatcgtctctttc
cgcgcagcgaatctatgtgccaccaccttggcggctatattggctcgtcttcgggagaac
aagaagctaaggcggctccgaacaaccgttgggatggatggaaccgtttacaaaacccat
ccgcaatttgctaaacgcctacataaagttgtgagaaggctggccccagagtgtgatgtc
cgatttctcctttccgagagtggaagtgggaaaggtgctgctatggtgaccgcggtggcg
tataggctggtgtcccagcgcaagcaggttgatgaagcactggctccttttaaactcacc
aaggatcagctttgtgaagtgaagaagagaatgagaacagagttggagcatgggctgaag
aaagaaactcatcataccgcatcagtcaaaatgctacccacatacgtctatggcacccca
gatggaacagaaagaggaaaatttctggcacttgaccttggagggaccaacttccgtgtt
ttacttgtcaaaatccgaagtggtctgaggaggtcagtcaggatgtataacaaaatttat
gccattcctttgtggatcatgcaagggacaggtgaagagctgtttgatcacattgtccag
tgcatctcggacttcctggattacatggggatgaaaggtgctcagctccctcttggcttc
acattctccttcccttgcagacaagctggcatcgataaggggactcttgttggctggaca
aaaggtttcaaagccacagactgtgaaggtgaagatgtagtggatttgttaagggaagct
attaaaaggagaaatgaatttgacctggacattgtggcagtggtgaatgatacagttggg
acaatgatgacctgcggatatgaggatccgaaatgtgaaattggactcattgcaggaacc
gggagcaatgtatgctacatggaagaaatgaggaatatagaattaatggagggagatgaa
gggagaatgtgtattaacacggagtggggagcatttggtgataatggatgtattgatgac
ctcagaactcagtttgacagagaggtcgatgagggatcgctaaatccagggaaacaaagg
tatgaaaaaatgaccagcggaatgtatttgggtgaaatagtaaggcaaattctaattcac
ttgaccaagcaagggcttctctttagaggtcaggtctctgaaagactcaagacgagaggc
atctttgagaccaaatttctctctcaaatcgaaagtgatgggctggcccttcttcaagtt
agagggatcctccaacagctgggtctggacagcacctgtgatgacagtataattgtgaag
gaggtatgcggtgtcatttccaggagggcagctcaactctgcggggctgggttagccgct
attgtggacaagattcgggaaaaccggaatctggactgccttgaggtcactgttggtgtg
gatggaaccctctacaaactgcacccacatttctctagggtcttacaggagacggtgaag
gaacaagctcccacgtgtggagtgactttcatgttatctgaagatgggagtggaaagggc
gcggccctaattaccgctgtggcgcggaggtttcatagcaacagacagcattag

DBGET integrated database retrieval system