KEGG   Larimichthys crocea (large yellow croaker): 104930237Help
Entry
104930237         CDS       T04659                                 

Gene name
setd1a
Definition
(RefSeq) histone-lysine N-methyltransferase SETD1A
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
lco  Larimichthys crocea (large yellow croaker)
Pathway
lco00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:lco00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    104930237 (setd1a)
Enzymes [BR:lco01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     104930237 (setd1a)
Chromosome and associated proteins [BR:lco03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     104930237 (setd1a)
   HMT complexes
    COMPASS/SET1 complex
     104930237 (setd1a)
    COMPASS/SET1 complex (yeast)
     104930237 (setd1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1
Motif
Other DBs
NCBI-GeneID: 104930237
NCBI-ProteinID: XP_019130665
LinkDB All DBs
Position
Un
AA seq 2207 aa AA seqDB search
MDPDGGAETQRAVSLQWKSYKLVQDPTIRRVTQKIYRYDGVHFSVPDSGFPPVGELRDPR
PRRLWSRYTELSLPVPKFKLDEFYVGPIPLKEVTFARLNDNIKEPFLAEMCAKFGEVEEM
EILFHPKTRKHLGLARVLFTSTRGAKDTVKQLHNTSVMGNIIHAQLDIKGQQRQKYYDLI
VNGSYTPQTVPLGGKALTDRVQPQAPTQPQPQPQPDTSSEIRRRLSSELAVLAAGVQALT
SGNITPCSADTGYSEQRLDTPPSSMAGSSASSQGGGGTPYSSRSGTPFSQESGYTGGRHT
GGYNTGTGSGYPPQDMLPSSSSSSAVSSTVGGYKVSRYSEDAQEPSVYHRGRPMYPPTAS
YRPNEPPCYPPYSSVGGPGPHMAHHSSMPPPPLATQYDQPPMADRDRDRERDSGGRYGAA
GIGSRRSSYHHQQDTNSSSKYHSHHSHHHSERRDERGYRRDSLGSRSGDHSHQRHRNHHH
SHNHHGSGSRRRSSHDRDRDRDRDRDRDRDRDRDSDYSNSSDPRYNSNSYRSSSNSMSPP
PSSYSAYSSKEPAPAPPQGLDASTRLGGTGLAERGSLPSVGTDKDYQAGHHSALPPPPPP
PPPLPPASVIAAAVAETLGTLDFNQDSPAREEQWTKPKRRPSTPPAPPKTPPPSSPPHPS
IASSSTSPSSTSLPHHLPSSSSSPPPPQRDSSSPEPDSTNESLPFVYHSSSLDSRIEMLL
KEQKAKFSFLASDEEDEEDRKEEKQRGIRGDGGERRGVSGDLSGEHISGNQVGDNGEKDH
RRKGERDRDGHRGRKRGKGGEGRKSPTIITATTPSSSTYASHILPPEEPQPQVSLTGTGT
LQEESSQAGSADTRSRIGAHTPPYNGQSQSSPHSSGEDMEISDEEEEETTITTVTTHQPS
VTSGSSPSSSQAAMPSQTTDPSSSPPPISDTAQHFGTSMHPPIPSYPPHLPPPPPPGYSL
QPPPPPGIPPLAHMELHPEYPPPMPHHMYDYATSMELMNQYSGGAPMSFQMQTHMLSRLH
QLRMSSTNGTPGPGEAATADYTSYHLHSMAPPHTHHPYMDQEGSGAGSHYDQDHRYMPQH
MPYPYADPHSSQIPPPPHHGIPPPHTAWPPHVIPPHYASYMPPPGYGTMLPGDGTEYRAP
GEEMPMLAENPHEATVQMVLGTLIQEMKNIMQRDLNRKMVENVAFATFDEWWERKETKAK
PFQTMVRGVSALRDDEKKEEKVNRPREPLTSLVDWAKSGGMEGFSLRGALRLPSFKVKRK
GPQELEEGDMKRQRPSTPPDEDDEAAEGRMPEADRHGAERDNKRRKKKPRSRKPWELGSE
GEETSDGSSSEKEDEEESEKGSDDDALSADSDDESLSSSSEGSSSSGSSSSSSSEDEDEE
EVEGLDSMDESTMDSTTEKEDDGANNAAAVSKAEVKTGEAKDSKADTTAAPTKRPPSPPY
PRPSSPIVLVPPLKKRRKTVSFSTAENDSKTQPPTAPLSPSLSQVAGESPLLSPGRPTDS
PITATPSPSPRPTQGIQLLPFASKPGEGNALIVPPSGRTQDSDETKKGPPVSPQTTPVKS
PGKRGAGKDSPKSPAPPVMVCRTVQNLPLDHASMCRMAFEEAPPPPPVNKRSRGRPRTTS
LSAPSCHSLREEDDEEESEQRLRLREQLGASSLLQLAAASTTDLSVLADVALKMDPDAGD
SEETETSDEAEEQKMEEDLFSPESLALVMSPDGVIVLMEHNYCKPPVLTVPSSSKRTSSK
QDSSVLLPADLNTISGVLEAPEEVIGEALPSRGDTGEYLPTMGVLCESEDVGQALPPSSK
KIVAGKGFEFENDKSKKRRRKDKENIEIHHTKKQKEQPGKKQRKRKLEDSDFEEDVDVEE
LESGELSSSDTEDEMVEEVRKSERLFLQEAGITSSQRWPKPIPAPEPLALKFENRSEFEQ
MTILYDIWNSGLDGEDLMLLKKTYEKLLQDDHSSDWLNDTHWVSHTVTNLPNPRRKKKNT
SGQLREHVTGCARSEGYYAISRKEKDVYLDLDLPEQVIREVENVDTSGANRVLSERRSEQ
RRLLTVIGTTAVMDSDLLKLNQLKYRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQ
NIRQMVADNREKRYAQQGIGSSYLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKVITI
ESQKKIVIYSKQAIAVNEEITYDYKFPLEENKIPCLCGTENCRGTLN
NT seq 6624 nt NT seq  +upstreamnt  +downstreamnt
atggatccagacggtggggcagaaacacaaagagctgtcagtttgcagtggaagagctac
aaactcgtccaggatccaactattcggcgggtcacacagaaaatctacagatatgacgga
gtgcatttcagtgtgccggactctggatttcctcccgtgggtgaactgcgggaccctagg
ccccggagactgtggtccaggtatacagagctgtccctgcccgtgccgaagtttaagctt
gatgagttctatgtgggtcccatacccctcaaggaggtgacctttgccaggctcaatgac
aacatcaaggagcctttcttggcagagatgtgtgccaagttcggtgaggtggaggaaatg
gaaatcctgtttcaccccaagaccaggaagcacttgggccttgccagggtgttgtttact
agcaccagaggagccaaggacacagtcaagcagctgcacaatacttctgtcatgggtaac
atcattcatgctcagctggatataaaaggccagcagaggcagaagtattatgacctgatc
gtaaatgggtcctacactcctcagacggtgcccctgggaggcaaggctttgacagacagg
gtccagcctcaggccccaacacagccacagccacagccacagcctgacacgtcatcagaa
atcaggcggaggctctccagtgagcttgcggttttggcagcaggggtacaggccctcaca
tcaggaaacatcaccccttgttctgcggataccggttacagcgaacagcgtctggacaca
cccccctcttcaatggcaggctcctctgcctcatcccagggaggtggaggaacaccttac
agctccagatctgggactcctttctcgcaagagtctggctacaccggtggcaggcatact
ggcggctacaacactggcactggcagcggctaccctccccaggacatgctaccttcctct
tcctcgtcctctgcggtctcttctactgttggaggatacaaagtgtctcgctactctgag
gatgcacaggaaccttcagtgtatcatcgaggtcgccctatgtatcccccaactgcatca
taccgtcccaatgagccaccatgctaccctccatactccagtgttggggggcctgggcca
cacatggcacatcactcctcaatgcctcctccgcctcttgccacccaatatgatcagcct
ccaatggcagacagggaccgagaccgtgaaagagactcagggggccgctatggggccgcg
gggattggctccagaaggtcatcttaccaccaccagcaagacacaaactcttcatcaaag
taccattcccatcactcccatcaccactcagaacgcagggatgaaagggggtaccggcga
gacagcctgggctcccgttcaggtgaccacagccaccagagacaccgtaaccaccaccat
tctcacaaccaccatggcagcggtagccgcagaaggagcagccatgaccgggacagggac
cgagatcgagacagagaccgcgatagagacagggacagagacagtgactactccaacagc
tctgacccaagatacaattccaactcttaccgctcttcctctaacagcatgtctcctccc
ccctcgtcttactctgcatactcctccaaagagcctgccccagcccctcctcagggattg
gacgcttccacccgtctagggggcacaggcctggcagagaggggctccctgccttcggta
ggcactgacaaagactaccaggctggtcaccacagtgctctacctccacctcccccaccg
cctcctccactcccacctgcctcagtcattgcagcggctgtagccgagacacttggaaca
ctggacttcaaccaggatagtccggcccgtgaagagcagtggacaaaacccaaacgccgt
cccagcaccccacctgcacctccaaagacacccccaccttcctctccaccccatccctcc
atcgcatcctcttctacatccccgtcctctacctccctcccacaccatcttccctcctcc
tccagctccccgccaccccctcagcgcgactcttcctctccagagccagattccaccaat
gagagtttaccgttcgtctaccacagcagcagccttgactctcgtattgagatgctccta
aaggaacaaaaggcaaaattttctttccttgcctccgatgaggaagacgaggaagacagg
aaagaggagaagcagaggggcatacgtggggatggaggagagcgaagaggtgtgtcaggt
gatctatcaggggagcacataagtggtaatcaggtgggagacaatggggagaaggaccac
aggagaaaaggggaaagagacagagatggccacagaggaaggaaacggggaaagggtgga
gaaggtaggaagagtcctacaataattacagcaaccacaccatcctcctccacctacgct
tcccacatcctgcccccggaggaaccccagccccaggtcagcctcactgggactggaact
ttgcaggaggagtcttcacaagctggatctgctgacacacgtagcaggataggagcacac
acaccaccgtacaatggacagagtcagtcctcccctcattcctcaggggaagacatggag
atctcagacgaggaggaggaggagactaccataacaacggtgaccacccaccagccctca
gtcacctcaggttcttcaccctcttcatcccaggctgccatgccctcacaaacaacggac
ccttcatcttcacccccacccatctctgacactgcacagcactttggcacctccatgcac
cctcccataccttcctacccccctcatttgcctcccccacctcctcccggttactccctc
cagcccccacctccacccgggatccctcccctggcccacatggagctgcaccccgagtat
cctcctcccatgccccaccacatgtatgactatgccacctccatggagctgatgaaccag
tacagtggtggagctcctatgtcctttcaaatgcagacccacatgttaagtcgcctacac
cagctgcgcatgtcgtcaaccaacggcaccccaggtcctggtgaggcagccactgcagac
tacacctcctaccatctccactctatggcaccaccccacacacaccacccctacatggac
caagagggaagcggggcaggctctcattatgaccaggaccaccgctacatgccccaacac
atgccctacccttacgctgacccccacagttctcagataccaccccctccccaccatggc
atcccgcctccccatactgcctggccgccacacgtcataccaccacactacgcctcttac
atgcccccgccaggatatggcaccatgctgcctggggatggaaccgagtacagggctcca
ggggaggagatgcccatgctggcagagaatccacatgaagccaccgtgcagatggtgctg
ggcactctgatccaggaaatgaaaaacatcatgcagagggacctgaatcgcaaaatggtg
gagaacgttgcttttgcaacttttgacgagtggtgggagaggaaagagaccaaggccaag
cctttccagacaatggttaggggggtgtctgccttacgggatgatgagaaaaaagaggaa
aaggtcaaccgtcctcgggagcctctcacgtctcttgtggattgggcaaagagtggtggc
atggagggattttctctcaggggagcgctacggctgccttccttcaaggtgaagaggaaa
ggacctcaagaattggaagagggagatatgaaaaggcagcgaccctcaaccccaccagac
gaggatgatgaagctgctgaagggagaatgccagaggcagacaggcatggagcagaaagg
gacaacaagaggaggaaaaagaagccaagaagtcgtaaaccttgggagcttggcagtgag
ggagaggaaacgtctgatggctcatcgagcgaaaaggaggatgaggaagaaagtgaaaag
gggtctgatgatgatgccctcagtgctgatagtgatgatgagagcctctcctcatcctct
gagggatcttcctcttcagggtcttcctcttcatcttcctctgaagatgaagatgaagag
gaggtcgagggactggacagcatggacgagtcaacaatggacagcacaacagagaaagag
gatgacggggcaaacaacgcagctgccgtttcaaaggcagaggtcaaaacaggtgaagcc
aaagacagcaaggcggatacaacagcagcacctaccaagcgtcctccatcacccccatac
ccgcgtccatcgtcccctattgttcttgttccccctctcaagaaacgcaggaagaccgtc
tcgttctccacagccgagaacgacagcaaaacgcagcccccaactgcgccgctgtctcca
tccctgtcacaagtggcgggtgaatctcccctcctctcccctggcaggcctacagactcc
cctatcactgctaccccatccccctcacctcgtcccactcagggcatccaactgctcccc
tttgcctccaaacccggtgaaggcaacgccctcatcgtgcccccatctggacggacccaa
gattctgatgagaccaaaaagggaccacctgtttctcctcagaccacccctgtcaaatca
cctgggaaacgtggagcagggaaagactcccccaaatctcccgcccctcctgttatggtg
tgccgcactgtgcagaacctgccgttggaccatgcctctatgtgcaggatggccttcgag
gaggcacctcctccacctcctgtcaacaaacggtccagaggcaggcctcggacgaccagc
ttgtctgctccttcctgtcactccctcagagaggaagatgatgaggaagaaagtgagcag
aggttgagactcagagagcaacttggggcatcaagcctcctgcagctggccgcagcttca
accaccgacctgtctgtgttggctgatgtagccctgaaaatggaccctgatgctggggac
tcagaggagacagagacctctgatgaggcagaagagcagaagatggaagaggatctcttc
tccccagagtcactggcccttgttatgagcccagacggtgtaattgtccttatggagcac
aactactgcaaaccccctgttctcacagtaccatccagtagcaaaaggacttcctccaaa
caagactcctctgtcttgctcccagcagacctcaacactatttctggggtgcttgaagca
ccagaggaagtcattggagaagcgctaccatccaggggagatacaggagaatacttacct
acaatgggagtgctttgtgagtctgaggatgtgggccaggctctacctccatcatcaaag
aagatcgtggctggcaaaggtttcgaatttgaaaatgacaagagcaaaaagaggagaaga
aaagacaaagaaaacattgagattcatcacacaaaaaaacagaaagagcagccaggcaag
aaacagaggaagcggaaactagaggactccgactttgaggaagatgtggatgtggaggag
cttgagtctggggagctctccagctcagacacagaggacgagatggtcgaagaggtgagg
aagagcgagcgcctctttctgcaggaggcagggataacgtcgtcccagcgctggccaaag
cctatcccagcacccgagccattagccctgaagtttgaaaaccgcagtgagtttgagcag
atgaccatcctgtatgacatctggaactctggtctggacggagaagacttgatgttactg
aagaagacttatgagaagctactacaggatgaccacagctctgactggctcaatgatact
cactgggtcagccacactgtaaccaatttgccgaaccctcggcgtaagaagaagaacaca
agtggacagcttcgtgagcatgtgaccggttgtgccaggagtgagggctactacgccatc
agccgcaaggagaaggacgtctatctggacctggacctacccgagcaggtcatacgggag
gtggagaatgtcgacacctcgggagctaacagggtgctatcagagagacgatcagagcag
cgccgcctcctcaccgtcattggcacaacggccgtcatggactctgacctgctcaaactc
aaccagcttaagtaccgcaagaagaagcttcgttttggacgcagcaggatccacgagtgg
ggcctgttcgccatggagcccattgctgctgatgagatggtgattgagtatgtgggtcaa
aacatcagacagatggtggctgacaatcgagagaagcggtacgcacagcagggcatcggg
agcagctatttgttcagagtggaccacgacacaattatagatgccaccaagtgtggaaac
ttggcacgattcatcaatcactgctgcactccaaattgctacgccaaggttatcaccata
gagtcccagaaaaagattgtgatctactcgaagcaggctatcgctgtcaacgaagagatc
acctacgactacaaattccccctcgaggagaataagattccttgcctgtgtggaacggag
aactgccgcgggacactgaactag

DBGET integrated database retrieval system