Leptosomus discolor (cuckoo roller): 104346001 Help Entry 104346001         CDS       T08399                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism ldi  Leptosomus discolor (cuckoo roller) Pathway ldi04010   MAPK signaling pathway ldi04012   ErbB signaling pathway ldi04068   FoxO signaling pathway ldi04137   Mitophagy - animal ldi04140   Autophagy - animal ldi04150   mTOR signaling pathway ldi04210   Apoptosis ldi04218   Cellular senescence ldi04370   VEGF signaling pathway ldi04371   Apelin signaling pathway ldi04540   Gap junction ldi04625   C-type lectin receptor signaling pathway ldi04810   Regulation of actin cytoskeleton ldi04910   Insulin signaling pathway ldi04912   GnRH signaling pathway ldi04916   Melanogenesis Brite KEGG Orthology (KO) [BR:ldi00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104346001 (NRAS)    04012 ErbB signaling pathway     104346001 (NRAS)    04370 VEGF signaling pathway     104346001 (NRAS)    04371 Apelin signaling pathway     104346001 (NRAS)    04068 FoxO signaling pathway     104346001 (NRAS)    04150 mTOR signaling pathway     104346001 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104346001 (NRAS)    04137 Mitophagy - animal     104346001 (NRAS)   09143 Cell growth and death    04210 Apoptosis     104346001 (NRAS)    04218 Cellular senescence     104346001 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     104346001 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104346001 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104346001 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     104346001 (NRAS)    04912 GnRH signaling pathway     104346001 (NRAS)    04916 Melanogenesis     104346001 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ldi04131]     104346001 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ldi04147]     104346001 (NRAS)    04031 GTP-binding proteins [BR:ldi04031]     104346001 (NRAS) Membrane trafficking [BR:ldi04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     104346001 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     104346001 (NRAS) Exosome [BR:ldi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104346001 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    104346001 (NRAS)   Exosomal proteins of breast cancer cells    104346001 (NRAS)   Exosomal proteins of colorectal cancer cells    104346001 (NRAS) GTP-binding proteins [BR:ldi04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     104346001 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf FeoB_N RsgA_GTPase MMR_HSR1 IL23 Motif Other DBs NCBI-GeneID:  104346001 NCBI-ProteinID:  XP_009948927 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search QDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLY REQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAQELAKSYGIPFIETSAKTRQGVEDAF YTLVREIRQYRMKKLNSNEDGNQGCMGLSCIVM NT seq 462 nt NT seq  +upstreamnt  +downstreamnt caggattcatatagaaagcaggttgttatcgatggagagacatgcttgttagacattctg gacactgcgggacaggaagagtatagtgccatgcgtgaccagtacatgagaactggggaa ggattcctctgtgtttttgccattaacaacagtaaatcgtttgctgatattaacctttac agagaacagatcaagagagtgaaagattcagatgatgtgccaatggtgctagttgggaat aagtgtgatttgcccacgagaacagtagacacaaaacaggctcaagaattagcaaaaagc tatggaatccccttcatagagacgtctgctaaaacaagacagggcgtcgaagatgctttt tacacactggtgagagagatccggcagtaccggatgaaaaagctcaacagcaacgaagat gggaatcaaggctgtatgggattgtcttgtattgtgatgtga

DBGET integrated database retrieval system