KEGG   Lentzea guizhouensis: BBK82_12845Help
Entry
BBK82_12845       CDS       T04448                                 

Definition
(GenBank) kynureninase
  KO
K01556  
kynureninase [EC:3.7.1.3]
Organism
led  Lentzea guizhouensis
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:led00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    BBK82_12845
Enzymes [BR:led01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     BBK82_12845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2565289..2566410
Genome map
AA seq 373 aa AA seqDB search
MDGEELRVRRELFDIPEGVIYLDGNSLGAPPKHVAERVQEVVKHQWGTRLIRSWSEGWWE
APQRIGDRIGRLVGAAPGQVVVGDSTSVNVFKALMGAVKGTGRTEIVVDESTFPTDGYIA
QSVASLTGLKIRPARPSSLDLTEDTAVVLLNHVDYRTGELLDMAEHTERAHAVGAQVVWD
LCHSAGVLPIELDALNVDYAIGCTYKFLNGGPGSPAFIYVPHAKQATFENPLSGWNGHRE
PFGMQPSYEPDPGIVRARVGTPDILSMLALDAALDVWDDVDLAELRQRGLQLTALFREHV
QKLTDLEVVTPEQRGNQISVRCPDAKNVMDELVNRGVIGDHRPPDVLRFGFAPLYVTDED
AVKAAEVLADVIR
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
ctggacggcgaggagctacgtgtgaggcgcgagctgttcgacatccccgaaggtgtcatc
tacctcgacggcaactcgctcggcgcaccaccgaagcacgtcgccgagcgtgtccaggag
gtcgtgaagcaccagtggggcacccggttgatccggtcgtggtccgaaggctggtgggag
gcaccgcaacggatcggtgaccggatcggcaggctcgtcggcgccgcacccggacaggtc
gtcgtcggcgattccacgtcggtcaacgtgttcaaggcgttgatgggcgcggtgaagggc
accggccgcaccgagatcgtggtcgacgagtcgacgttcccgaccgacgggtacatcgcg
cagtccgtggcgtcgttgaccgggctgaagatccgtccagcgcgtccgtcctctttggac
ctcactgaggacaccgcggtggtgctgctcaaccacgtcgactaccgcaccggcgagctg
ctcgacatggcggaacacaccgagcgagcgcatgccgttggcgcgcaggtggtctgggac
ctctgccacagcgcgggcgtgctgccgatcgagctggacgcgctgaacgtcgactacgcg
atcggctgcacctacaagttcttgaacggcgggcccggctcgccggcgttcatctacgtg
ccgcacgcgaagcaggccacgttcgagaacccgctgtcgggctggaacgggcaccgcgag
ccgttcggcatgcagccgtcctacgagccggatcccggcatcgtccgggcgcgggtcggt
acgccggacatcctgtcgatgctggcgctcgacgcggcgctggacgtctgggacgacgtg
gacctcgccgagctgaggcagcgcgggttgcagctcacggcgttgttccgcgagcacgtc
cagaagctcacggacctcgaggtggtcacgccggagcagcgcggcaaccagatctcggtg
cgctgcccggacgcgaagaacgtcatggacgagctggtcaaccgcggcgtcatcggcgac
caccggccgcccgacgtcctgcggttcgggttcgcgccgctctacgtgaccgacgaggac
gcggtgaaggccgccgaggtcctggccgacgtcatccggtga

DBGET integrated database retrieval system