KEGG   Lentzea guizhouensis: BBK82_21075Help
Entry
BBK82_21075       CDS       T04448                                 

Definition
(GenBank) maltose alpha-D-glucosyltransferase
  KO
K05343  
maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
led  Lentzea guizhouensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:led00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BBK82_21075
Enzymes [BR:led01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BBK82_21075
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     BBK82_21075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(4222112..4223920)
Genome map
AA seq 602 aa AA seqDB search
MVDDPRPDAALGLEGTPHTGEAIDDDGFLVEPQAEDFKSARQAKPNPDWYKGAVFYEVLV
RAFSDSNGDGTGDLRGLASRLDYLEWLGVDCLWLPPFYASPLRDGGYDISDFRAVLPEFG
TVEDFVYLLEEAHRRGIRVITDLVLNHTSDAHPWFQESRQNPDGPYGDYYVWSDDDSRYS
DARIIFVDTESSNWTYDPVRGQFFWHRFFSHQPDLNYENPEVQEAMLDILRFWLDLGIDG
FRLDAVPYLFEEEGTICENLPRTHEFLKKCRKVVDDEFPGRVLLAEANQWPSDVVEYFGD
PAVGGDECHMAFHFPLMPRIFMAVRRESRFPISEILAQTPAIPENSQWGIFLRNHDELTL
EMVTDEERDYMYSEYAKDPRMKANIGIRRRLAPLLENDRNQHELFTAMLLSLPGSPVLYY
GDEIGMGDNIWLADRDAVRTPMQWTPDRNAGFSSCDPGRIYLPVIMDPVYGYQGLNVEAQ
LNNSSSLLNWTRHMIEVRKQHHAFAEGDFTELGGSNPSVLAFKRQWKRPDGREDIVLCVN
NLSRFPQPVELDLSEHRDYTPVELTGGVKFPSIGELPYLLTLPGHGFYWFQLVEAGDDSE
MR
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacgacccgcgtcccgacgctgcgctcgggctggaaggaacaccgcacaccggc
gaagccatcgacgacgacggtttcctggtcgagccgcaggccgaggacttcaagtccgcc
cggcaggcgaagccgaacccggactggtacaagggcgccgtcttctacgaggtcctggtc
cgggcgttcagcgactccaacggtgacgggaccggtgacctcagagggctcgcgtcccgg
ctggactacctggagtggctcggggtcgactgcctgtggctgcctccgttctacgcctcg
ccgttgcgcgacggcgggtacgacatcagcgacttccgggcggtgctgccggagttcggg
acggtcgaggacttcgtctacctgctggaggaggcgcaccggcggggtatccgggtgatc
accgacctggtgctcaaccacacctcggacgcccacccgtggttccaggagtcgaggcag
aacccggacggcccgtacggcgactactacgtgtggagcgacgacgactcgcgctactcc
gacgcgcggatcatcttcgtggacacggagtcgtcgaactggacgtacgacccggtgcgc
gggcagttcttctggcaccgcttcttcagccaccagccggacctcaactacgagaacccg
gaagtgcaggaggcgatgctcgacatcctgcggttctggctcgacctcggcatcgacggc
ttccgcctcgacgccgtgccctacctcttcgaggaggagggcacgatctgcgagaacctg
ccgcgcacgcacgagttcctgaagaagtgccgcaaggtcgtcgacgacgagttccccggc
cgggtgctgctggcggaggcgaaccagtggccgtcggacgtggtcgagtacttcggcgac
cccgcggtgggcggcgacgagtgccacatggcgttccacttcccgctgatgccgcggatc
ttcatggcggtgcggcgcgagtcgcggttcccgatctcggagatcctggcgcagacgccg
gcgatcccggagaactcccagtggggcatcttcctgcgcaaccacgacgagctgacgctc
gagatggtgacggacgaagagcgcgactacatgtactcggagtacgccaaggacccgcgg
atgaaggcgaacatcggcatccgccgccgcctggccccgttgctggagaacgaccgcaac
cagcacgagctgttcaccgccatgctgctgtcactaccgggctcgcccgttctctactac
ggcgacgagatcggcatgggcgacaacatctggctcgccgaccgcgacgccgtgcgcacg
ccgatgcagtggaccccggaccgcaacgcgggcttctcgtcatgtgaccccggccggatc
tacctgccggtgatcatggacccggtctacggctaccagggcctcaacgtcgaggcgcag
ctgaacaactcgtcgtcgctgctgaactggacgcggcacatgatcgaggtgcgcaagcag
caccacgcgttcgccgagggcgacttcaccgagctgggtggctcgaacccgagcgtgctc
gccttcaagcggcagtggaagcgccccgacgggcgtgaggacatcgtcctgtgcgtgaac
aacctctcccgcttcccccaaccggtcgagctggacctctccgagcaccgcgactacacg
ccggtggagctgaccggaggtgtcaaattcccctcgatcggggaactcccgtacctgttg
acccttcccggtcacggtttctactggttccagctggtagaggcgggcgacgacagcgag
atgaggtga

DBGET integrated database retrieval system